Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Mammalian cells |
Applications | Elisa, WB |
Product name | Recombinant Human Insulin-like growth factor-binding protein 1 (IGFBP1) |
---|---|
Uniprot ID | P08833 |
Uniprot link | http://www.uniprot.org/uniprot/P08833 |
Origin species | Homo sapiens (Human) |
Expression system | Eukaryotic expression |
Sequence | MSEVPVARVWLVLLLLTVQVGVTAGAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQNGSHHHHHH |
Molecular weight | 28.82kDa |
Protein delivered with Tag? | Yes |
Purity estimated | 60%-70% |
Buffer | PBS, pH 7.5 |
Form | Lyophilized |
Delivery condition | Dry Ice |
Delivery lead time in business days | 10-25 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Mammalian cells |
Fragment Type | Full-length |
Aliases /Synonyms | IGFBP1, IBP1, AFBP, IGF-BP25, PP12, Placental Protein 12, Amniotic Fluid Binding Protein, Alpha-Pregnancy-Associated Endometrial Globulin, Growth Hormone Independent-Binding Protein |
Reference | PX-P4057 |
Note | For research use only |
Send us a message from the form below
Reviews
There are no reviews yet.