Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Recombinant Human Insulin-like growth factor-binding protein 1 (IGFBP1)
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | Recombinant Human Insulin-like growth factor-binding protein 1 (IGFBP1) |
|---|---|
| Uniprot ID | P08833 |
| Uniprot link | http://www.uniprot.org/uniprot/P08833 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MSEVPVARVWLVLLLLTVQVGVTAGAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQNGSHHHHHH |
| Molecular weight | 28.82kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 60%-70% |
| Buffer | PBS, pH 7.5 |
| Form | Lyophilized |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Full-length |
| Aliases /Synonyms | IGFBP1, IBP1, AFBP, IGF-BP25, PP12, Placental Protein 12, Amniotic Fluid Binding Protein, Alpha-Pregnancy-Associated Endometrial Globulin, Growth Hormone Independent-Binding Protein |
| Reference | PX-P4057 |
| Note | For research use only |
Contact us
Send us a message from the form below
Reviews
There are no reviews yet.