Brand: ProteoGenix

Recombinant Human Insulin-like growth factor-binding protein 1 (IGFBP1)

PX-P4057-100
Quality Chart

Host species:: Mammalian cells
Origin species:: Homo sapiens (Human)
Uniprot ID:: P08833
Molecular weight:: 28.82kDa

$500.00

100ug + 500 loyalty points

Full-length Yes

size size

50ug $250.00
100ug $500.00

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

Recombinant Human Insulin-like growth factor-binding protein 1 (IGFBP1)

Product name	Recombinant Human Insulin-like Growth Factor proteins-binding protein 1 (IGFBP1)
Uniprot ID	P08833
Uniprot link	http://www.uniprot.org/uniprot/P08833
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Raw Antigen Sequence	MSEVPVARVWLVLLLLTVQVGVTAGAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQNGSHHHHHH
Molecular weight	28.82kDa
Protein delivered with Tag?	Yes
Purity estimated	60%-70%
Buffer	PBS, pH 7.5
Form	Lyophilized
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Full-length
Aliases /Synonyms	IGFBP1, IBP1, AFBP, IGF-BP25, PP12, Placental Protein 12, Amniotic Fluid Binding Protein, Alpha-Pregnancy-Associated Endometrial Globulin, Growth Hormone Independent-Binding Protein
Reference	PX-P4057
Note	For research use only
Molecular Constructor	Full-length Yes

Product name	Recombinant Human Insulin-like Growth Factor proteins-binding protein 1 (IGFBP1)
Uniprot ID	P08833
Uniprot link	http://www.uniprot.org/uniprot/P08833
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Raw Antigen Sequence	MSEVPVARVWLVLLLLTVQVGVTAGAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQNGSHHHHHH
Molecular weight	28.82kDa
Protein delivered with Tag?	Yes
Purity estimated	60%-70%
Buffer	PBS, pH 7.5
Form	Lyophilized
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Full-length
Aliases /Synonyms	IGFBP1, IBP1, AFBP, IGF-BP25, PP12, Placental Protein 12, Amniotic Fluid Binding Protein, Alpha-Pregnancy-Associated Endometrial Globulin, Growth Hormone Independent-Binding Protein
Reference	PX-P4057
Note	For research use only
Molecular Constructor	Full-length Yes

There are no reviews yet.

Be the first to review “Recombinant Human Insulin-like growth factor-binding protein 1 (IGFBP1)”

Recombinant Human Insulin-like growth factor-binding protein 1 (IGFBP1)

Recombinant Human Insulin-like growth factor-binding protein 1 (IGFBP1)

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Recombinant Human Insulin-like growth factor-binding protein 1 (IGFBP1)

Specifications Recombinant Human Insulin-like growth factor-binding protein 1 (IGFBP1)

Documents

Reviews

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Recombinant Human Insulin-like growth factor-binding protein 1 (IGFBP1)