Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Rhesus monkey IL37 – Interleukin 1 Zeta (IL1z) recombinant protein
| Size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Rhesus monkey IL37 - Interleukin 1 Zeta (IL1z) recombinant protein |
|---|---|
| Origin species | Rhesus monkey |
| Expression system | Prokaryotic expression |
| Sequence | MGSHHHHHHSGLVPRGSMSNNSTLKMSFVGENSGVKTGSEDWEKDEPQCYSEKDEPQCYSEDPAGSPLEPGPSLPSMNFVHTSPKVKNLNPKKFSIHDQDHKVLVVDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLSCDKDKGQSHPSLQLKKKKLMKLAALKESARRPFIFYRAQVGSRNTLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD |
| Molecular weight | 27.71kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 95% |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 2-3 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Full-length |
| NCBI Reference | XP_011722821.1 |
| Aliases /Synonyms | IL1F7, IL37, FIL1, FIL1(ZETA), FIL1Z, IL-1F7, IL-1H4, IL-1RP1, IL1H4, IL1RP1, Interleukin 37, Interleukin-1-Related Protein, Interleukin 1 Family, Member 7 |
| Reference | PX-P4063 |
| Note | For research use only |
Contact us
Send us a message from the form below
Reviews
There are no reviews yet.