Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | Rhesus monkey IL37 - Interleukin 1 Zeta (IL1z) recombinant protein |
---|---|
Origin species | Rhesus monkey |
Expression system | Prokaryotic expression |
Sequence | MGSHHHHHHSGLVPRGSMSNNSTLKMSFVGENSGVKTGSEDWEKDEPQCYSEKDEPQCYSEDPAGSPLEPGPSLPSMNFVHTSPKVKNLNPKKFSIHDQDHKVLVVDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLSCDKDKGQSHPSLQLKKKKLMKLAALKESARRPFIFYRAQVGSRNTLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD |
Molecular weight | 27.71kDa |
Protein delivered with Tag? | Yes |
Purity estimated | 95% |
Delivery condition | Dry Ice |
Delivery lead time in business days | 2-3 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Full-length |
NCBI Reference | XP_011722821.1 |
Aliases /Synonyms | IL1F7, IL37, FIL1, FIL1(ZETA), FIL1Z, IL-1F7, IL-1H4, IL-1RP1, IL1H4, IL1RP1, Interleukin 37, Interleukin-1-Related Protein, Interleukin 1 Family, Member 7 |
Reference | PX-P4063 |
Note | For research use only |
Send us a message from the form below
Reviews
There are no reviews yet.