Cart (0 Items)
Your cart is currently empty.
View Products
              
              
              | Size | 100ug, 50ug  | 
		
|---|---|
| Brand | ProteoGenix  | 
		
| Product type | Recombinant Proteins  | 
		
| Host Species | Escherichia coli (E. coli)  | 
		
| Applications | Elisa, WB  | 
		
| Product name | Rhesus monkey IL37 - Interleukin 1 Zeta (IL1z) recombinant protein | 
|---|---|
| Origin species | Rhesus monkey | 
| Expression system | Prokaryotic expression | 
| Sequence | MGSHHHHHHSGLVPRGSMSNNSTLKMSFVGENSGVKTGSEDWEKDEPQCYSEKDEPQCYSEDPAGSPLEPGPSLPSMNFVHTSPKVKNLNPKKFSIHDQDHKVLVVDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLSCDKDKGQSHPSLQLKKKKLMKLAALKESARRPFIFYRAQVGSRNTLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD | 
| Molecular weight | 27.71kDa | 
| Protein delivered with Tag? | Yes | 
| Purity estimated | 95% | 
| Delivery condition | Dry Ice | 
| Delivery lead time in business days | 2-3 | 
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) | 
| Brand | ProteoGenix | 
| Host species | Escherichia coli (E.coli) | 
| Fragment Type | Full-length | 
| NCBI Reference | XP_011722821.1 | 
| Aliases /Synonyms | IL1F7, IL37, FIL1, FIL1(ZETA), FIL1Z, IL-1F7, IL-1H4, IL-1RP1, IL1H4, IL1RP1, Interleukin 37, Interleukin-1-Related Protein, Interleukin 1 Family, Member 7 | 
| Reference | PX-P4063 | 
| Note | For research use only | 
Send us a message from the form below
Reviews
There are no reviews yet.