Name: Rhesus monkey IL37 - Interleukin 1 Zeta (IL1z) recombinant protein
SKU: PX-P4063-10
Availability: InStock

Product name	Rhesus monkey IL37 - Interleukin 1 Zeta (IL1z) recombinant protein
Origin species	Rhesus monkey
Expression system	Prokaryotic expression
Sequence	MGSHHHHHHSGLVPRGSMSNNSTLKMSFVGENSGVKTGSEDWEKDEPQCYSEKDEPQCYSEDPAGSPLEPGPSLPSMNFVHTSPKVKNLNPKKFSIHDQDHKVLVVDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLSCDKDKGQSHPSLQLKKKKLMKLAALKESARRPFIFYRAQVGSRNTLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD
Molecular weight	27.71kDa
Protein delivered with Tag?	Yes
Purity estimated	95%
Delivery condition	Dry Ice
Delivery lead time in business days	2-3
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Full-length
NCBI Reference	XP_011722821.1
Aliases /Synonyms	IL1F7, IL37, FIL1, FIL1(ZETA), FIL1Z, IL-1F7, IL-1H4, IL-1RP1, IL1H4, IL1RP1, Interleukin 37, Interleukin-1-Related Protein, Interleukin 1 Family, Member 7
Reference	PX-P4063
Note	For research use only

No Products found