Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Rhesus monkey IL37 – Interleukin 1 Zeta (IL1z) recombinant protein

Host species:
Escherichia coli (E.coli)
Origin species:
Rhesus monkey
Molecular weight:
27.71kDa

$392.00

100ug + 392 loyalty points
Full-length Yes
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Rhesus monkey IL37 - Interleukin 1 Zeta (IL1z) recombinant protein

Product name Rhesus monkey IL37 - Interleukin 1 Zeta (IL1z) recombinant protein
Origin species Rhesus monkey
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGLVPRGSMSNNSTLKMSFVGENSGVKTGSEDWEKDEPQCYSEKDEPQCYSEDPAGSPLEPGPSLPSMNFVHTSPKVKNLNPKKFSIHDQDHKVLVVDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLSCDKDKGQSHPSLQLKKKKLMKLAALKESARRPFIFYRAQVGSRNTLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD
Molecular weight 27.71kDa
Protein delivered with Tag? Yes
Purity estimated 95%
Delivery condition Dry Ice
Delivery lead time in business days 2-3
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
NCBI Reference XP_011722821.1
Aliases /Synonyms IL1F7, IL37, FIL1, FIL1(ZETA), FIL1Z, IL-1F7, IL-1H4, IL-1RP1, IL1H4, IL1RP1, Interleukin 37, Interleukin-1-Related Protein, Interleukin 1 Family, Member 7
Reference PX-P4063
Note For research use only
Molecular Constructor
Full-length Yes
Product name Rhesus monkey IL37 - Interleukin 1 Zeta (IL1z) recombinant protein
Origin species Rhesus monkey
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGLVPRGSMSNNSTLKMSFVGENSGVKTGSEDWEKDEPQCYSEKDEPQCYSEDPAGSPLEPGPSLPSMNFVHTSPKVKNLNPKKFSIHDQDHKVLVVDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLSCDKDKGQSHPSLQLKKKKLMKLAALKESARRPFIFYRAQVGSRNTLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD
Molecular weight 27.71kDa
Protein delivered with Tag? Yes
Purity estimated 95%
Delivery condition Dry Ice
Delivery lead time in business days 2-3
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
NCBI Reference XP_011722821.1
Aliases /Synonyms IL1F7, IL37, FIL1, FIL1(ZETA), FIL1Z, IL-1F7, IL-1H4, IL-1RP1, IL1H4, IL1RP1, Interleukin 37, Interleukin-1-Related Protein, Interleukin 1 Family, Member 7
Reference PX-P4063
Note For research use only
Molecular Constructor
Full-length Yes

There are no reviews yet.

Be the first to review “Rhesus monkey IL37 – Interleukin 1 Zeta (IL1z) recombinant protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products