Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Rhesus monkey TAFA2 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Rhesus monkey
Uniprot ID:
G7N7I3
Molecular weight:
13,16 kDa

$587.00

100ug + 587 loyalty points
Partial Yes
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Rhesus monkey TAFA2 Recombinant Protein

Rhesus monkey TAFA2 Recombinant Protein

Product name Rhesus monkey TAFA2 Recombinant Protein
Uniprot ID G7N7I3
Uniprot link http://www.uniprot.org/uniprot/G7N7I3
Origin species Rhesus monkey
Expression system Prokaryotic expression
Sequence MAHNHRHKHKLDDDDKANHHKAHHVKTGTCEVVALHRCCNKNKIEERSQTVKCSCFPGQVAGTTRAAPSCVDASIVEQKW WCHMQPCLEGEECKVLPDRKGWSCSSGNKVKTTRVTH
Molecular weight 13,16 kDa
Protein delivered with Tag? Yes
Purity estimated 80% native (degradation + contaminant) >95% denatured
Buffer PBS, imidazole 300mM in natives conditions. PBS, imidazole 10mM, Urea 8M in denaturing conditions
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession EHH20918.1
Spec:SwissProtID F6PPL1
NCBI Reference EHH20918.1
Aliases /Synonyms TAFA2, Chemokine-like protein TAFA-2
Reference PX-P1158
Note For research use only
Molecular Constructor
Partial Yes
Product name Rhesus monkey TAFA2 Recombinant Protein
Uniprot ID G7N7I3
Uniprot link http://www.uniprot.org/uniprot/G7N7I3
Origin species Rhesus monkey
Expression system Prokaryotic expression
Sequence MAHNHRHKHKLDDDDKANHHKAHHVKTGTCEVVALHRCCNKNKIEERSQTVKCSCFPGQVAGTTRAAPSCVDASIVEQKW WCHMQPCLEGEECKVLPDRKGWSCSSGNKVKTTRVTH
Molecular weight 13,16 kDa
Protein delivered with Tag? Yes
Purity estimated 80% native (degradation + contaminant) >95% denatured
Buffer PBS, imidazole 300mM in natives conditions. PBS, imidazole 10mM, Urea 8M in denaturing conditions
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession EHH20918.1
Spec:SwissProtID F6PPL1
NCBI Reference EHH20918.1
Aliases /Synonyms TAFA2, Chemokine-like protein TAFA-2
Reference PX-P1158
Note For research use only
Molecular Constructor
Partial Yes

There are no reviews yet.

Be the first to review “Rhesus monkey TAFA2 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products