Rhesus monkey TAFA2 Recombinant Protein

Reference:
Size

100ug, 50ug

Brand

Product type

Host Species

Applications

,

Product nameRhesus monkey TAFA2 Recombinant Protein
Uniprot IDG7N7I3
Uniprot linkhttp://www.uniprot.org/uniprot/G7N7I3
Origin speciesRhesus monkey
Expression systemProkaryotic expression
SequenceMAHNHRHKHKLDDDDKANHHKAHHVKTGTCEVVALHRCCNKNKIEERSQTVKCSCFPGQVAGTTRAAPSCVDASIVEQKW WCHMQPCLEGEECKVLPDRKGWSCSSGNKVKTTRVTH
Molecular weight13,16 kDa
Protein delivered with Tag?Yes
Purity estimated80% native (degradation + contaminant) >95% denatured
BufferPBS, imidazole 300mM in natives conditions. PBS, imidazole 10mM, Urea 8M in denaturing conditions
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypePartial
Protein AccessionEHH20918.1
Spec:SwissProtIDF6PPL1
NCBI ReferenceEHH20918.1
Aliases /SynonymsTAFA2, Chemokine-like protein TAFA-2
ReferencePX-P1158
NoteFor research use only

Description of Rhesus monkey TAFA2 Recombinant Protein

Introduction

The Rhesus monkey TAFA2 Recombinant Protein is a highly promising drug target in the field of neuroscience. This protein has been extensively studied and has shown potential in treating various neurological disorders. In this article, we will delve into the structure, activity, and application of this protein in detail.

Structure of Rhesus monkey TAFA2 Recombinant Protein

Rhesus monkey TAFA2 Recombinant Protein is a member of the TAFA (TAFA chemokine-like family) family of proteins. It is a small secreted protein with a molecular weight of approximately 10 kDa. The protein is composed of 116 amino acids and has a conserved cysteine-rich domain. The three-dimensional structure of this protein has been determined through X-ray crystallography, revealing a compact globular structure with a distinct fold.

Activity of this protein

Rhesus monkey TAFA2 Recombinant Protein has been found to have a wide range of activities in the central nervous system. It acts as a neuroprotective agent and has been shown to promote neuronal survival and growth. This protein also plays a crucial role in modulating the immune response in the brain, as it has been found to have both pro-inflammatory and anti-inflammatory properties. Additionally, Rhesus monkey TAFA2 Recombinant Protein has been shown to enhance synaptic plasticity, which is essential for learning and memory.

One of the most remarkable activities of Rhesus monkey TAFA2 Recombinant Protein is its ability to promote neurogenesis. Neurogenesis is the process of generating new neurons in the brain, and it is crucial for maintaining brain health and function. Studies have shown that this protein can stimulate the proliferation and differentiation of neural stem cells, leading to an increase in the number of new neurons in the brain. This activity makes Rhesus monkey TAFA2 Recombinant Protein a potential therapeutic target for neurodegenerative disorders such as Alzheimer’s and Parkinson’s disease.

Application of Rhesus monkey TAFA2 Recombinant Protein

The promising activities of Rhesus monkey TAFA2 Recombinant Protein make it a potential candidate for the treatment of various neurological disorders. It has been studied in animal models of Alzheimer’s disease, where it has been found to improve cognitive function and reduce amyloid-beta plaque formation in the brain. In animal models of multiple sclerosis, this protein has been shown to reduce inflammation and promote remyelination, which is the process of repairing damaged nerve cells.

Rhesus monkey TAFA2 Recombinant Protein has also shown potential in treating stroke. Studies have demonstrated that this protein can protect brain cells from damage caused by lack of oxygen and blood flow during a stroke. It has also been found to improve functional recovery and reduce brain tissue damage in animal models of stroke.

Furthermore, Rhesus monkey TAFA2 Recombinant Protein has been investigated for its potential in treating depression and anxiety. It has been shown to have anxiolytic and antidepressant effects, possibly through its ability to promote neurogenesis and modulate the immune response in the brain.

Conclusion

In conclusion, Rhesus monkey TAFA2 Recombinant Protein is a highly promising drug target with a wide range of activities in the central nervous system. Its neuroprotective, anti-inflammatory, and neurogenic properties make it a potential therapeutic agent for various neurological disorders. Further research and clinical trials are needed to fully understand the potential of this protein and its application in treating human diseases.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Rhesus monkey TAFA2 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Send us a message from the form below







    Cart (0 Items)

    Your cart is currently empty.

    View Products