Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
RNA-binding protein 38(RBM38)
| Size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | RNA-binding protein 38(RBM38) |
|---|---|
| Uniprot ID | Q9H0Z9 |
| Uniprot link | https://www.uniprot.org/uniprot/Q9H0Z9 |
| Expression system | Prokaryotic expression |
| Sequence | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSTLIQRTYGLTPHYIYPPAIVQPSVVIPAAPVPSLSSPYIEYTPASPAYAQYPPATYDQYPYAASPATAASFVGYSYPAAVPQALSAAAPAGTTFVQYQAPQLQPDRMQ |
| Molecular weight | 38.3kDa |
| Protein delivered with Tag? | N-terminal GST Tag |
| Purity estimated | >75% by SDS-PAGE |
| Buffer | PBS, pH 7.5, 4M urea |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Thr132-Gln239 |
| Protein Accession | Q9H0Z9 |
| Spec:Entrez GeneID | 55544 |
| Spec:NCBI Gene Aliases | RNPC1; SEB4B; SEB4D; HSRNASEB; dJ800J21.2 |
| NCBI Reference | Q9H0Z9 |
| Aliases /Synonyms | CLL-associated antigen KW-5,HSRNASEB,RNA-binding motif protein 38,RNA-binding region-containing protein 1,ssDNA-binding protein SEB4,RNPC1, SEB4 |
| Reference | PX-P4832 |
| Note | For research use only |
Related products
Tag Antibody
Anti GST tag mouse monoclonal antibody
PTX17859 215$Contact us
Send us a message from the form below
Reviews
There are no reviews yet.