Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | Slit homolog 2 protein(SLIT2) |
---|---|
Uniprot ID | O94813 |
Uniprot link | http://www.uniprot.org/uniprot/O94813 |
Expression system | Prokaryotic expression |
Sequence | MGKYLLPTAAAGLLLLAAQPAMALHCPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRR IDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKL QTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRCGSHHHHHH |
Molecular weight | 26.50kDa |
Purity estimated | >80% by SDS-PAGE |
Buffer | PBS PH7.5, 4M urea |
Delivery condition | Dry Ice |
Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Leu271-Cys478 |
Aliases /Synonyms | SLIL3,Slit-2 |
Reference | PX-P4478 |
Note | For research use only |
Slit2 is a member of the Slit family. It can send signals through the Roundabout (Robo) receptor and act as a repellent for axon guidance and neuronal migration. It can also act as a chemotactic factor for vascular endothelial cells and a chemotaxis inhibitor for white blood cells. Slit2 is mainly expressed in the lungs, kidneys and adult spinal cord of fetuses, but less in the adrenal glands, thyroid and trachea of adults. Slit2 was originally synthesized as a precursor of 1499 amino acids, and then cleaved into N-terminal and C-terminal fragments, named Slit2-N and Slit2-C, respectively. As measured by the ability to reject olfactory bulb axons and induce branching in dorsal root ganglion axons, activities related to neurodevelopment are only contained in the N-terminal segment.
Send us a message from the form below
Reviews
There are no reviews yet.