Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Solrikitug Biosimilar – Anti-TSLP mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $221.00.Current price is: $167.00.

50ug 24% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Solrikitug Biosimilar - Anti-TSLP mAb - Research Grade

Product name PX-TA2142-50
Uniprot ID Q969D9
Source CAS: 2768721-24-8
Origin species Humanized
Expression system XtenCHO
Raw Antigen Sequence MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2142
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Solrikitug Biosimilar - Anti-TSLP mAb - Research Grade
Uniprot ID Q969D9
Source CAS: 2768721-24-8
Origin species Humanized
Expression system XtenCHO
Raw Antigen Sequence MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2142
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Solrikitug Biosimilar - Anti-TSLP mAb - Research Grade
Uniprot ID Q969D9
Source CAS: 2768721-24-8
Origin species Humanized
Expression system XtenCHO
Raw Antigen Sequence MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2142
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Solrikitug Biosimilar: A Revolutionary Anti-TSLP mAb for Targeted Therapy

Solrikitug Biosimilar is a novel monoclonal antibody (mAb) that specifically targets thymic stromal lymphopoietin (TSLP), a cytokine that plays a crucial role in the pathogenesis of various inflammatory and allergic diseases. This biosimilar is a research grade product that offers a promising alternative to traditional treatments for these conditions.

Structure of Solrikitug Biosimilar

Solrikitug Biosimilar is a fully humanized IgG1 monoclonal antibody, with a molecular weight of approximately 150 kDa. It is produced using recombinant DNA technology, where the gene coding for the antibody is inserted into host cells, resulting in the production of large quantities of the pure antibody. The structure of Solrikitug Biosimilar is highly specific and tightly binds to TSLP, making it an effective therapeutic agent.

Activity of Solrikitug Biosimilar

The main mechanism of action of Solrikitug Biosimilar is its ability to neutralize TSLP, a key cytokine involved in the initiation and maintenance of allergic and inflammatory responses. TSLP is produced by various cells, including epithelial cells, mast cells, and dendritic cells, in response to allergens, viruses, and other triggers. It then activates immune cells, such as T cells and eosinophils, leading to the release of pro-inflammatory cytokines and chemokines. This cascade of events ultimately results in the development of allergic and inflammatory diseases.

Solrikitug Biosimilar specifically binds to TSLP, preventing it from activating immune cells and halting the inflammatory cascade. This not only reduces the symptoms of allergic and inflammatory diseases but also addresses the underlying cause, making it a highly targeted and effective therapy.

Application of Solrikitug Biosimilar

Solrikitug Biosimilar has shown promising results in preclinical studies and is currently being evaluated in clinical trials for the treatment of various allergic and inflammatory diseases, including asthma, atopic dermatitis, and eosinophilic esophagitis. It has the potential to provide a safe and effective treatment option for patients who do not respond to conventional therapies or experience significant side effects.

Furthermore, Solrikitug Biosimilar can also be used as a research tool to study the role of TSLP in various disease conditions. Its high specificity and potency make it an ideal candidate for in vitro and in vivo studies, providing valuable insights into the mechanisms of TSLP and its potential as a therapeutic target.

Conclusion

Solrikitug Biosimilar is a revolutionary anti-TSLP mAb that offers a targeted and effective approach to treating allergic and inflammatory diseases. Its specific structure and mechanism of action make it a promising alternative to traditional therapies, with the potential to improve the quality of life for patients and advance research in this field. As clinical trials continue to demonstrate its safety and efficacy, Solrikitug Biosimilar has the potential to become a game-changing therapy for patients suffering from these debilitating conditions.

Keywords:

antibody, therapeutic target, Solrikitug Biosimilar, anti-TSLP mAb, structure, activity, application, research grade, cytokine, inflammatory diseases, allergic diseases, monoclonal antibody, TSLP neutralization, preclinical studies, clinical trials, asthma, atopic dermatitis, eosinophilic esophagitis, research tool, in vitro, in vivo, targeted therapy, traditional treatments, quality of life.

SDS-PAGE for Research Grade Solrikitug

SDS-PAGE for Research Grade Solrikitug

Research Grade Solrikitug, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Solrikitug Biosimilar - Anti-TSLP mAb - Research Grade

There are no reviews yet.

Be the first to review “Solrikitug Biosimilar – Anti-TSLP mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products