Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Staphylococcus 6His-Protein A
| size | 10mg |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Product name | Staphylococcus 6His-Protein A |
|---|---|
| Uniprot ID | P38507 |
| Uniprot link | http://www.uniprot.org/uniprot/P38507 |
| Origin species | Staphylococcus |
| Expression system | Procaryotic expression |
| Sequence | MGAQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNKFNKDQQSAFYEILNMPNLNEEQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLP |
| Molecular weight | 33.83 KDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 90% |
| Buffer | PBS,pH7.5 |
| Form | Frozen |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Partial |
| Spec:SwissProtID | P38507 |
| NCBI Reference | EYF82342.1 |
| Aliases /Synonyms | 6His-Protein A |
| Reference | PX-P2101 |
| Note | For research use only |
Contact us
Send us a message from the form below
Reviews
There are no reviews yet.