Skip to main content

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Staphylococcus 6His-Protein A

Host species:
Escherichia coli (E.coli)
Origin species:
Staphylococcus
Uniprot ID:
P38507
Molecular weight:
33.83 KDa

$675.00

+ 675 loyalty points
Partial Yes
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Staphylococcus 6His-Protein A

Product name Staphylococcus 6His-Protein A
Uniprot ID P38507
Uniprot link http://www.uniprot.org/uniprot/P38507
Origin species Staphylococcus
Expression system Procaryotic expression
Sequence MGAQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNKFNKDQQSAFYEILNMPNLNEEQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLP
Molecular weight 33.83 KDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS,pH7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Spec:SwissProtID P38507
NCBI Reference EYF82342.1
Aliases /Synonyms 6His-Protein A
Reference PX-P2101
Note For research use only
Background information Array
Molecular Constructor
Partial Yes

There are no reviews yet.

Be the first to review “Staphylococcus 6His-Protein A”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products