Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Staphylococcus GlmR3 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Staphylococcus
Uniprot ID:
Q99V41
Molecular weight:
 21.14 kDa

Original price was: $313.00.Current price is: $250.00.

50ug 20% OFF + 250 loyalty points
Partial
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Staphylococcus GlmR3 Recombinant Protein

Product name Staphylococcus GlmR3 Recombinant Protein
Uniprot ID Q99V41
Uniprot link http://www.uniprot.org/uniprot/Q99V41
Origin species Staphylococcus
Expression system Prokaryotic expression
Raw Antigen Sequence MAHNHRHKHKLAYTVTKPQTTQTVSKIAQVKPNNTGIRASVYEKTAKNGAKYADRTFYVTKERAHGNETYVLLNNTSHNIPLGWFNVKDLNVQNLGKEVKTTQKYTVNKSNNGLSMVPWGTKNQVILTGNNIAQGTFNATKQVSVGKDVYLYGTINNRTGWVNAKDLTAPTAVKPTTSAAKDYNYTYVIK
Molecular weight  21.14 kDa
Purity estimated 85%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession WP_031826599.1
Spec:Entrez GeneID 1123728
Spec:SwissProtID Q99V41
NCBI Reference  WP_031826599.1
Aliases /Synonyms GlmR3, Bifunctional autolysin, atl, nag, SA0905
Reference PX-P2073
Note For research use only
Molecular Constructor
Partial
Product name Staphylococcus GlmR3 Recombinant Protein
Uniprot ID Q99V41
Uniprot link http://www.uniprot.org/uniprot/Q99V41
Origin species Staphylococcus
Expression system Prokaryotic expression
Raw Antigen Sequence MAHNHRHKHKLAYTVTKPQTTQTVSKIAQVKPNNTGIRASVYEKTAKNGAKYADRTFYVTKERAHGNETYVLLNNTSHNIPLGWFNVKDLNVQNLGKEVKTTQKYTVNKSNNGLSMVPWGTKNQVILTGNNIAQGTFNATKQVSVGKDVYLYGTINNRTGWVNAKDLTAPTAVKPTTSAAKDYNYTYVIK
Molecular weight  21.14 kDa
Purity estimated 85%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession WP_031826599.1
Spec:Entrez GeneID 1123728
Spec:SwissProtID Q99V41
NCBI Reference  WP_031826599.1
Aliases /Synonyms GlmR3, Bifunctional autolysin, atl, nag, SA0905
Reference PX-P2073
Note For research use only
Molecular Constructor
Partial
Product name PX-P2073-1MG
Uniprot ID Q99V41
Uniprot link http://www.uniprot.org/uniprot/Q99V41
Origin species Staphylococcus
Expression system Prokaryotic expression
Raw Antigen Sequence MAHNHRHKHKLAYTVTKPQTTQTVSKIAQVKPNNTGIRASVYEKTAKNGAKYADRTFYVTKERAHGNETYVLLNNTSHNIPLGWFNVKDLNVQNLGKEVKTTQKYTVNKSNNGLSMVPWGTKNQVILTGNNIAQGTFNATKQVSVGKDVYLYGTINNRTGWVNAKDLTAPTAVKPTTSAAKDYNYTYVIK
Molecular weight  21.14 kDa
Purity estimated 85%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession WP_031826599.1
Spec:Entrez GeneID 1123728
Spec:SwissProtID Q99V41
NCBI Reference  WP_031826599.1
Aliases /Synonyms GlmR3, Bifunctional autolysin, atl, nag, SA0905
Reference PX-P2073
Note For research use only
Molecular Constructor
Partial

General information on Staphylococcus GlmR3 Recombinant Protein

Bifunctional autolysin from Staphylococcus aureus has multiple roles; it hydrolyzes the link between N-acetylmuramoyl residues and L-amino acid residues in certain cell-wall glycopeptides. It acts as endohydrolysis of the N,N’-diacetylchitobiosyl unit in high-mannose glycopeptides and glycoproteins containing the -(Man(GlcNAc)2)Asn-structure. It cleaves the peptidoglycan connecting the daughter cells at the end of the cell division cycle, resulting in the separation of the two newly divided cells. Acts as an autolysin in penicillin-induced lysis.

Staphylococcus GlmR3 Recombinant Protein

  • Kuroda M, Ohta T, Uchiyama I, Baba T, Yuzawa H, Kobayashi I, Cui L, Oguchi A, Aoki K, Nagai Y, Lian J, Ito T, Kanamori M, Matsumaru H, Maruyama A, Murakami H, Hosoyama A, Mizutani-Ui Y, Takahashi NK, Sawano T, Inoue R, Kaito C, Sekimizu K, Hirakawa H, Kuhara S, Goto S, Yabuzaki J, Kanehisa M, Yamashita A, Oshima K, Furuya K, Yoshino C, Shiba T, Hattori M, Ogasawara N, Hayashi H, Hiramatsu K. Whole genome sequencing of meticillin-resistant Staphylococcus aureus. Lancet. 2001 Apr 21;357(9264):1225-40. PubMed PMID: 11418146.

There are no reviews yet.

Be the first to review “Staphylococcus GlmR3 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products