Skip to main content

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now

Tobacco TEV Protease Recombinant Enzyme

Reference:
size

1000U, 100U, 500U

Brand

ProteoGenix

Product type

Recombinant Proteins

Host Species

Escherichia coli (E. coli)

Applications

Elisa, WB

Product nameTobacco TEV Protease Recombinant Enzyme
Origin speciesTobacco
Expression systemProkaryotic expression
SequenceMSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSGESLFKGPR DYNPISSTICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLVVQSLHGVFKVKDTTTLQQHLIDGRDMMIIRMPK DFPPFPQKLKFREPQREERICLVTTNFQAKSMSSMVSDTSCTFPSGDGIFWKHWIQTKDGQCGSPLVSTRDGFIVGIHSA SNFTNTNNYFTSVPKNFMELLTNQEAQQWVSGWRLNADSVLWGGHKVFMVKPEEPFQPVKEATQLMNELVYSQ
Molecular weight54,23 kDa
Protein delivered with Tag?N-terminal GST Tag
Buffer50 mM,pH8.0, 0.5 mM EDTA,DTT 1mM
FormFrozen
Delivery conditionDry Ice
Delivery lead time in business days5-7
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypeProperty sequence
Protein AccessionNP_734212.1
NCBI ReferenceNP_734212.1
Aliases /SynonymsGST-TEV, NIa-Pro protein (TEV protease)
ReferencePX-P1108
NoteFor research use only

Description of Tobacco TEV Protease Recombinant Enzyme

General information on Tobacco TEV Protease Recombinant Enzyme:

TEV (Tobacco Etch Virus) Protease is a highly site-specific cysteine protease that is found in the Tobacco Etch Virus. Due to its high sequence specificity it is regularly used to cleave affinity tags from fusion proteins. The TEV encodes its whole genome as a single massive polyprotein. This is cleaved into functional units by the three proteases: P1 protease (1 cleavage site), helper-component protease (1 cleavage site) and TEV protease (7 cleavage sites). The greatest recognition site for this enzyme is the sequence Glu-Asn-Leu-Tyr-Phe-Gln-(Gly/Ser) [ENLYFQ/S] and cleavage appear between the Gln and Gly/Ser residues.

Publication

  • 1: Martínez F, Daròs JA. Tobacco etch virus protein P1 traffics to the nucleolus _x000D_ and associates with the host 60S ribosomal subunits during infection. J Virol._x000D_ 2014 Sep;88(18):10725-37. doi: 10.1128/JVI.00928-14. Epub 2014 Jul 2. PubMed_x000D_ PMID: 24991017; PubMed Central PMCID: PMC4178839.
  • _x000D_ _x000D_ _x000D_
  • 2: Cui X, Wei T, Chowda-Reddy RV, Sun G, Wang A. The Tobacco etch virus P3_x000D_ protein forms mobile inclusions via the early secretory pathway and traffics_x000D_ along actin microfilaments. Virology. 2010 Feb 5;397(1):56-63. doi:_x000D_ 10.1016/j.virol.2009.11.015. Epub 2009 Nov 30. PubMed PMID: 19945728.
  • _x000D_ _x000D_ _x000D_
  • 3: Torres-Barceló C, Martín S, Daròs JA, Elena SF. From hypo- to_x000D_ hypersuppression: effect of amino acid substitutions on the RNA-silencing_x000D_ suppressor activity of the Tobacco etch potyvirus HC-Pro. Genetics. 2008_x000D_ Oct;180(2):1039-49. doi: 10.1534/genetics.108.091363. Epub 2008 Sep 9. PubMed_x000D_ PMID: 18780745; PubMed Central PMCID: PMC2567354.
  • _x000D_ _x000D_ _x000D_
  • 4: Allison RF, Dougherty WG, Parks TD, Willis L, Johnston RE, Kelly M, Armstrong _x000D_ FB. Biochemical analysis of the capsid protein gene and capsid protein of tobacco_x000D_ etch virus: N-terminal amino acids are located on the virion's surface. Virology._x000D_ 1985 Dec;147(2):309-16. PubMed PMID: 18640560.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Tobacco TEV Protease Recombinant Enzyme”

Your email address will not be published. Required fields are marked *

Related products

Anti GST tag mouse monoclonal antibody
Tag Antibody

Anti GST tag mouse monoclonal antibody

PTX17859 214$

Contact us

Send us a message from the form below

    Cart (0 Items)

    Your cart is currently empty.

    View Products