Cart (0 Items)
Your cart is currently empty.
View Productssize | 1000U, 100U, 500U |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | Tobacco TEV Protease Recombinant Enzyme |
---|---|
Origin species | Tobacco |
Expression system | Prokaryotic expression |
Sequence | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSGESLFKGPR DYNPISSTICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLVVQSLHGVFKVKDTTTLQQHLIDGRDMMIIRMPK DFPPFPQKLKFREPQREERICLVTTNFQAKSMSSMVSDTSCTFPSGDGIFWKHWIQTKDGQCGSPLVSTRDGFIVGIHSA SNFTNTNNYFTSVPKNFMELLTNQEAQQWVSGWRLNADSVLWGGHKVFMVKPEEPFQPVKEATQLMNELVYSQ |
Molecular weight | 54,23 kDa |
Protein delivered with Tag? | N-terminal GST Tag |
Buffer | 50 mM,pH8.0, 0.5 mM EDTA,DTT 1mM |
Form | Frozen |
Delivery condition | Dry Ice |
Delivery lead time in business days | 5-7 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Property sequence |
Protein Accession | NP_734212.1 |
NCBI Reference | NP_734212.1 |
Aliases /Synonyms | GST-TEV, NIa-Pro protein (TEV protease) |
Reference | PX-P1108 |
Note | For research use only |
TEV (Tobacco Etch Virus) Protease is a highly site-specific cysteine protease that is found in the Tobacco Etch Virus. Due to its high sequence specificity it is regularly used to cleave affinity tags from fusion proteins. The TEV encodes its whole genome as a single massive polyprotein. This is cleaved into functional units by the three proteases: P1 protease (1 cleavage site), helper-component protease (1 cleavage site) and TEV protease (7 cleavage sites). The greatest recognition site for this enzyme is the sequence Glu-Asn-Leu-Tyr-Phe-Gln-(Gly/Ser) [ENLYFQ/S] and cleavage appear between the Gln and Gly/Ser residues.
Related products
Send us a message from the form below
Reviews
There are no reviews yet.