Skip to main content
Contact +1 (919) 234-1277

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Tobacco TEV Protease Recombinant Enzyme

Host species:
Escherichia coli (E.coli)
Origin species:
Tobacco
Molecular weight:
54,23 kDa

$161.00

100U + 161 loyalty points
GST Property sequence
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Tobacco TEV Protease Recombinant Enzyme

Tobacco TEV Protease Recombinant Enzyme

Product name Tobacco TEV Protease Recombinant Enzyme
Origin species Tobacco
Expression system Prokaryotic expression
Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSGESLFKGPR DYNPISSTICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLVVQSLHGVFKVKDTTTLQQHLIDGRDMMIIRMPK DFPPFPQKLKFREPQREERICLVTTNFQAKSMSSMVSDTSCTFPSGDGIFWKHWIQTKDGQCGSPLVSTRDGFIVGIHSA SNFTNTNNYFTSVPKNFMELLTNQEAQQWVSGWRLNADSVLWGGHKVFMVKPEEPFQPVKEATQLMNELVYSQ
Molecular weight 54,23 kDa
Protein delivered with Tag? N-terminal GST Tag
Buffer 50 mM，pH8.0, 0.5 mM EDTA,DTT 1mM
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Property sequence
Protein Accession NP_734212.1
NCBI Reference NP_734212.1
Aliases /Synonyms GST-TEV, NIa-Pro protein (TEV protease)
Reference PX-P1108
Note For research use only
Molecular Constructor
GST Property sequence
Product name Tobacco TEV Protease Recombinant Enzyme
Origin species Tobacco
Expression system Prokaryotic expression
Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSGESLFKGPR DYNPISSTICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLVVQSLHGVFKVKDTTTLQQHLIDGRDMMIIRMPK DFPPFPQKLKFREPQREERICLVTTNFQAKSMSSMVSDTSCTFPSGDGIFWKHWIQTKDGQCGSPLVSTRDGFIVGIHSA SNFTNTNNYFTSVPKNFMELLTNQEAQQWVSGWRLNADSVLWGGHKVFMVKPEEPFQPVKEATQLMNELVYSQ
Molecular weight 54,23 kDa
Protein delivered with Tag? N-terminal GST Tag
Buffer 50 mM?pH8.0, 0.5 mM EDTA,DTT 1mM
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Property sequence
Protein Accession NP_734212.1
NCBI Reference NP_734212.1
Aliases /Synonyms GST-TEV, NIa-Pro protein (TEV protease)
Reference PX-P1108
Note For research use only
Molecular Constructor
GST Property sequence
Product name Tobacco TEV Protease Recombinant Enzyme
Origin species Tobacco
Expression system Prokaryotic expression
Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSGESLFKGPR DYNPISSTICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLVVQSLHGVFKVKDTTTLQQHLIDGRDMMIIRMPK DFPPFPQKLKFREPQREERICLVTTNFQAKSMSSMVSDTSCTFPSGDGIFWKHWIQTKDGQCGSPLVSTRDGFIVGIHSA SNFTNTNNYFTSVPKNFMELLTNQEAQQWVSGWRLNADSVLWGGHKVFMVKPEEPFQPVKEATQLMNELVYSQ
Molecular weight 54,23 kDa
Protein delivered with Tag? N-terminal GST Tag
Buffer 50 mM?pH8.0, 0.5 mM EDTA,DTT 1mM
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Property sequence
Protein Accession NP_734212.1
NCBI Reference NP_734212.1
Aliases /Synonyms GST-TEV, NIa-Pro protein (TEV protease)
Reference PX-P1108
Note For research use only
Molecular Constructor
GST Property sequence
Product name Tobacco TEV Protease Recombinant Enzyme
Origin species Tobacco
Expression system Prokaryotic expression
Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSGESLFKGPR DYNPISSTICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLVVQSLHGVFKVKDTTTLQQHLIDGRDMMIIRMPK DFPPFPQKLKFREPQREERICLVTTNFQAKSMSSMVSDTSCTFPSGDGIFWKHWIQTKDGQCGSPLVSTRDGFIVGIHSA SNFTNTNNYFTSVPKNFMELLTNQEAQQWVSGWRLNADSVLWGGHKVFMVKPEEPFQPVKEATQLMNELVYSQ
Molecular weight 54,23 kDa
Protein delivered with Tag? N-terminal GST Tag
Buffer 50 mM，pH8.0, 0.5 mM EDTA,DTT 1mM
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Property sequence
Protein Accession NP_734212.1
NCBI Reference NP_734212.1
Aliases /Synonyms GST-TEV, NIa-Pro protein (TEV protease)
Reference PX-P1108
Note For research use only
Molecular Constructor
GST Property sequence
Product name Tobacco TEV Protease Recombinant Enzyme
Origin species Tobacco
Expression system Prokaryotic expression
Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSGESLFKGPR DYNPISSTICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLVVQSLHGVFKVKDTTTLQQHLIDGRDMMIIRMPK DFPPFPQKLKFREPQREERICLVTTNFQAKSMSSMVSDTSCTFPSGDGIFWKHWIQTKDGQCGSPLVSTRDGFIVGIHSA SNFTNTNNYFTSVPKNFMELLTNQEAQQWVSGWRLNADSVLWGGHKVFMVKPEEPFQPVKEATQLMNELVYSQ
Molecular weight 54,23 kDa
Protein delivered with Tag? N-terminal GST Tag
Buffer 50 mM，pH8.0, 0.5 mM EDTA,DTT 1mM
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Property sequence
Protein Accession NP_734212.1
NCBI Reference NP_734212.1
Aliases /Synonyms GST-TEV, NIa-Pro protein (TEV protease)
Reference PX-P1108
Note For research use only
Molecular Constructor
GST Property sequence
Product name Tobacco TEV Protease Recombinant Enzyme
Origin species Tobacco
Expression system Prokaryotic expression
Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSGESLFKGPR DYNPISSTICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLVVQSLHGVFKVKDTTTLQQHLIDGRDMMIIRMPK DFPPFPQKLKFREPQREERICLVTTNFQAKSMSSMVSDTSCTFPSGDGIFWKHWIQTKDGQCGSPLVSTRDGFIVGIHSA SNFTNTNNYFTSVPKNFMELLTNQEAQQWVSGWRLNADSVLWGGHKVFMVKPEEPFQPVKEATQLMNELVYSQ
Molecular weight 54,23 kDa
Protein delivered with Tag? N-terminal GST Tag
Buffer 50 mM，pH8.0, 0.5 mM EDTA,DTT 1mM
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Property sequence
Protein Accession NP_734212.1
NCBI Reference NP_734212.1
Aliases /Synonyms GST-TEV, NIa-Pro protein (TEV protease)
Reference PX-P1108
Note For research use only
Molecular Constructor
GST Property sequence

General information on Tobacco TEV Protease Recombinant Enzyme:

TEV (Tobacco Etch Virus) Protease is a highly site-specific cysteine protease that is found in the Tobacco Etch Virus. Due to its high sequence specificity it is regularly used to cleave affinity tags from fusion proteins. The TEV encodes its whole genome as a single massive polyprotein. This is cleaved into functional units by the three proteases: P1 protease (1 cleavage site), helper-component protease (1 cleavage site) and TEV protease (7 cleavage sites). The greatest recognition site for this enzyme is the sequence Glu-Asn-Leu-Tyr-Phe-Gln-(Gly/Ser) [ENLYFQ/S] and cleavage appear between the Gln and Gly/Ser residues.

  • Martínez F, Daròs JA. Tobacco etch virus protein P1 traffics to the nucleolus and associates with the host 60S ribosomal subunits during infection. J Virol. 2014 Sep;88(18):10725-37. doi: 10.1128/JVI.00928-14. Epub 2014 Jul 2. PubMed PMID: 24991017; PubMed Central PMCID: PMC4178839.
  • Cui X, Wei T, Chowda-Reddy RV, Sun G, Wang A. The Tobacco etch virus P3 protein forms mobile inclusions via the early secretory pathway and traffics along actin microfilaments. Virology. 2010 Feb 5;397(1):56-63. doi: 10.1016/j.virol.2009.11.015. Epub 2009 Nov 30. PubMed PMID: 19945728.
  • Torres-Barceló C, Martín S, Daròs JA, Elena SF. From hypo- to hypersuppression: effect of amino acid substitutions on the RNA-silencing suppressor activity of the Tobacco etch potyvirus HC-Pro. Genetics. 2008 Oct;180(2):1039-49. doi: 10.1534/genetics.108.091363. Epub 2008 Sep 9. PubMed PMID: 18780745; PubMed Central PMCID: PMC2567354.
  • Allison RF, Dougherty WG, Parks TD, Willis L, Johnston RE, Kelly M, Armstrong FB. Biochemical analysis of the capsid protein gene and capsid protein of tobacco etch virus: N-terminal amino acids are located on the virion's surface. Virology. 1985 Dec;147(2):309-16. PubMed PMID: 18640560.

There are no reviews yet.

Be the first to review “Tobacco TEV Protease Recombinant Enzyme”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products