Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | Tomato Sl_eIF4E2 Recombinant Protein |
---|---|
Origin species | Tomato |
Expression system | Prokaryotic expression |
Sequence | MGSSHHHHHHSSGLVPRGSHMMADELNKAALEEYKSSSVEDRGEEGEIVGESDDTASSLGKQITMKHPLEHSWTFWFDNP SGKSKQAAWGSSIRPIYTFSTAEDFWSVYNNIHHPSKLAVGADFHCFKNKIEPKWEDPVCANGGKWTMNFSRGKSDTCWL YTLLALIGEQFDYGDEICGAVINVRVRQEKIALWTRNAANETAQDV |
Molecular weight | 23,10 kDa |
Purity estimated | ≥50% |
Buffer | PBS, Urea 8M |
Form | liquid |
Delivery condition | Dry Ice |
Delivery lead time in business days | 10-25 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Partial |
Protein Accession | XP_004231545.1 |
NCBI Reference | XP_004231545.1 |
Aliases /Synonyms | Sl_eIF4E2, eukaryotic translation initiation factor 4E-1-like |
Reference | PX-P1151 |
Note | For research use only |
Belongs to a small multigenic family and three genes, eIF4E1, eIF4E2 and eIF(iso)4E, have been identified in tomato. It has been demonstrated that eIF4E-mediated natural recessive resistances against potyviruses result from non-synonymous mutations in an eIF4E protein, which impair its direct interaction with the potyviral protein VPg. In tomato, the role of eIF4E proteins in potyvirus resistance is still unclear because natural or induced mutations in eIF4E1 confer only a narrow resistance spectrum against potyviruses. This contrasts with the broad spectrum resistance identified in the natural diversity of tomato.
Send us a message from the form below
Reviews
There are no reviews yet.