Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tomato Sl_eIF4E2 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Tomato
Molecular weight:
23,10 kDa

$250.00

50ug + 250 loyalty points
Partial
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Tomato Sl_eIF4E2 Recombinant Protein

Product name Tomato Sl_eIF4E2 Recombinant Protein
Origin species Tomato
Expression system Prokaryotic expression
Sequence MGSSHHHHHHSSGLVPRGSHMMADELNKAALEEYKSSSVEDRGEEGEIVGESDDTASSLGKQITMKHPLEHSWTFWFDNP SGKSKQAAWGSSIRPIYTFSTAEDFWSVYNNIHHPSKLAVGADFHCFKNKIEPKWEDPVCANGGKWTMNFSRGKSDTCWL YTLLALIGEQFDYGDEICGAVINVRVRQEKIALWTRNAANETAQDV
Molecular weight 23,10 kDa
Purity estimated ≥50%
Buffer PBS, Urea 8M
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession XP_004231545.1
NCBI Reference XP_004231545.1
Aliases /Synonyms Sl_eIF4E2, eukaryotic translation initiation factor 4E-1-like
Reference PX-P1151
Note For research use only
Molecular Constructor
Partial
Product name Tomato Sl_eIF4E2 Recombinant Protein
Origin species Tomato
Expression system Prokaryotic expression
Sequence MGSSHHHHHHSSGLVPRGSHMMADELNKAALEEYKSSSVEDRGEEGEIVGESDDTASSLGKQITMKHPLEHSWTFWFDNP SGKSKQAAWGSSIRPIYTFSTAEDFWSVYNNIHHPSKLAVGADFHCFKNKIEPKWEDPVCANGGKWTMNFSRGKSDTCWL YTLLALIGEQFDYGDEICGAVINVRVRQEKIALWTRNAANETAQDV
Molecular weight 23,10 kDa
Purity estimated ≥50%
Buffer PBS, Urea 8M
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession XP_004231545.1
NCBI Reference XP_004231545.1
Aliases /Synonyms Sl_eIF4E2, eukaryotic translation initiation factor 4E-1-like
Reference PX-P1151
Note For research use only
Molecular Constructor
Partial

General information on Tomato Sl_eIF4E2 Recombinant Protein

Belongs to a small multigenic family and three genes, eIF4E1, eIF4E2 and eIF(iso)4E, have been identified in tomato. It has been demonstrated that eIF4E-mediated natural recessive resistances against potyviruses result from non-synonymous mutations in an eIF4E protein, which impair its direct interaction with the potyviral protein VPg. In tomato, the role of eIF4E proteins in potyvirus resistance is still unclear because natural or induced mutations in eIF4E1 confer only a narrow resistance spectrum against potyviruses. This contrasts with the broad spectrum resistance identified in the natural diversity of tomato.

  • Gauffier C, Lebaron C, Moretti A, Constant C, Moquet F, Bonnet G, Caranta C, Gallois JL. A TILLING approach to generate broad-spectrum resistance to potyviruses in tomato is hampered by eIF4E gene redundancy. Plant J. 2016 Mar;85(6):717-29. doi: 10.1111/tpj.13136. PubMed PMID: 26850324.
  • Mazier M, Flamain F, Nicolaï M, Sarnette V, Caranta C. Knock-down of both eIF4E1 and eIF4E2 genes confers broad-spectrum resistance against potyviruses in tomato. PLoS One. 2011;6(12):e29595. doi: 10.1371/journal.pone.0029595. Epub 2011 Dec 29. PubMed PMID: 22242134; PubMed Central PMCID: PMC3248445.
  • Aoki K, Yano K, Suzuki A, Kawamura S, Sakurai N, Suda K, Kurabayashi A, Suzuki T, Tsugane T, Watanabe M, Ooga K, Torii M, Narita T, Shin-I T, Kohara Y, Yamamoto N, Takahashi H, Watanabe Y, Egusa M, Kodama M, Ichinose Y, Kikuchi M, Fukushima S, Okabe A, Arie T, Sato Y, Yazawa K, Satoh S, Omura T, Ezura H, Shibata D. Large-scale analysis of full-length cDNAs from the tomato (Solanum lycopersicum) cultivar Micro-Tom, a reference system for the Solanaceae genomics. BMC Genomics. 2010 Mar 30;11:210. doi: 10.1186/1471-2164-11-210. PubMed PMID: 20350329; PubMed Central PMCID: PMC2859864.

There are no reviews yet.

Be the first to review “Tomato Sl_eIF4E2 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products