Cart (0 Items)
Your cart is currently empty.
View Products
| Size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Toxoplasma gondii GRA1(25-190)(RH) Recombinant Protein |
|---|---|
| Uniprot ID | P13403 |
| Uniprot link | http://www.uniprot.org/uniprot/P13403 |
| Origin species | Toxoplasma gondii |
| Expression system | Prokaryotic expression |
| Sequence | MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLAEGGDNQSSAVSDRASLFGLLSGGTGQGLGIGESVDLEMMGNTY RVERPTGNPDLLKIAIKASDGSYSEVGNVNVEEVIDTMKSMQRDEDIFLRALNKGETVEEAIEDVAQAEGLNSEQTLQLE DAVSAVASVVQDEMKVIDDVQQLEKDKQQLKDDIGFLTGERELEHHHHHH |
| Molecular weight | 22,92 kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | >95% |
| Buffer | PBS, imidazole 300mM |
| Form | liquid |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Partial |
| Protein Accession | P13403.1 |
| Spec:SwissProtID | P13403 |
| NCBI Reference | P13403.1 |
| Aliases /Synonyms | GRA1(25-190)(RH) (=14), Dense granule protein 1 , Protein GRA 1, Major antigen p24, Dense granule protein 1 |
| Reference | PX-P1093 |
| Note | For research use only |
Dense granules are specific secretory organelles. Dense granule protein 1 (GRA1) of Toxoplasma gondii is located in the dense granules of two forms: tachyzoite and bradyzoite. It has an immunoprophylactic interest in toxoplasmosis.
Send us a message from the form below
Reviews
There are no reviews yet.