Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Toxoplasma gondii GRA1(25-190)(RH) Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Toxoplasma gondii
Uniprot ID:
P13403
Molecular weight:
22,92 kDa

$250.00

50ug + 250 loyalty points
Partial Yes
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Toxoplasma gondii GRA1(25-190)(RH) Recombinant Protein

Product name Toxoplasma gondii GRA1(25-190)(RH) Recombinant Protein
Uniprot ID P13403
Uniprot link http://www.uniprot.org/uniprot/P13403
Origin species Toxoplasma gondii
Expression system Prokaryotic expression
Raw Antigen Sequence MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLAEGGDNQSSAVSDRASLFGLLSGGTGQGLGIGESVDLEMMGNTY RVERPTGNPDLLKIAIKASDGSYSEVGNVNVEEVIDTMKSMQRDEDIFLRALNKGETVEEAIEDVAQAEGLNSEQTLQLE DAVSAVASVVQDEMKVIDDVQQLEKDKQQLKDDIGFLTGERELEHHHHHH
Molecular weight 22,92 kDa
Protein delivered with Tag? Yes
Purity estimated >95%
Buffer PBS, imidazole 300mM
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession P13403.1
Spec:SwissProtID P13403
NCBI Reference P13403.1
Aliases /Synonyms GRA1(25-190)(RH) (=14), Dense granule protein 1 , Protein GRA 1, Major antigen p24, Dense granule protein 1
Reference PX-P1093
Note For research use only
Molecular Constructor
Partial Yes
Product name Toxoplasma gondii GRA1(25-190)(RH) Recombinant Protein
Uniprot ID P13403
Uniprot link http://www.uniprot.org/uniprot/P13403
Origin species Toxoplasma gondii
Expression system Prokaryotic expression
Raw Antigen Sequence MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLAEGGDNQSSAVSDRASLFGLLSGGTGQGLGIGESVDLEMMGNTY RVERPTGNPDLLKIAIKASDGSYSEVGNVNVEEVIDTMKSMQRDEDIFLRALNKGETVEEAIEDVAQAEGLNSEQTLQLE DAVSAVASVVQDEMKVIDDVQQLEKDKQQLKDDIGFLTGERELEHHHHHH
Molecular weight 22,92 kDa
Protein delivered with Tag? Yes
Purity estimated >95%
Buffer PBS, imidazole 300mM
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession P13403.1
Spec:SwissProtID P13403
NCBI Reference P13403.1
Aliases /Synonyms GRA1(25-190)(RH) (=14), Dense granule protein 1 , Protein GRA 1, Major antigen p24, Dense granule protein 1
Reference PX-P1093
Note For research use only
Molecular Constructor
Partial Yes

General information on Toxoplasma gondii GRA1(25-190)(RH) Recombinant Protein:

Dense granules are specific secretory organelles. Dense granule protein 1 (GRA1) of Toxoplasma gondii is located in the dense granules of two forms: tachyzoite and bradyzoite. It has an immunoprophylactic interest in toxoplasmosis.

Toxoplasma gondii GRA1(25-190)(RH) Recombinant Protein

  • Cesbron-Delauw MF, Guy B, Torpier G, Pierce RJ, Lenzen G, Cesbron JY, Charif H, Lepage P, Darcy F, Lecocq JP, et al. Molecular characterization of a 23-kilodalton major antigen secreted by Toxoplasma gondii. Proc Natl Acad Sci U S A. 1989 Oct;86(19):7537-41. PubMed PMID: 2798425; PubMed Central PMCID: PMC298100.

There are no reviews yet.

Be the first to review “Toxoplasma gondii GRA1(25-190)(RH) Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products