Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | Trichinella spiralis NBL-1 Recombinant Protein |
---|---|
Uniprot ID | Q9BJL7 |
Uniprot link | http://www.uniprot.org/uniprot/Q9BJL7 |
Origin species | Trichinella spiralis |
Expression system | Prokaryotic expression |
Sequence | MAHNHRHKHKLAFECGVPHFKPYIWKSGRIVGGTDVRPHSHPWQIQLLKSETGGYSSLCGGSLVHFGKPSNGTRFVLTAA HCITTSNMYPRTSRFTVVTGAHNIKMHEKEKKRIPITSYYVQHWNPVMTTNDIALLRLAETVYYNEYTRPVCLPEPNEEL TPGDICVVTGWGDTTENGTTSNTLKQVGVKIMKKGTCANVRSEVITFCAGAMEGGKDSCQGDSGGPLICKKNGKSVQFGV VSYGTGCARKGYPGVYAKVPSYVTWLNKAAKELENSPEGTVKWASKEDSPVDLSTASRPTNPYTGSRPTSPSSGSRPTYP SSGSRPTSPSSGSRPTYPSSGSRPTYPSSGSRPTYPYTGSRPTPQKPVFPSYQKYPPAVQKYIDSLPSGTQGTLEYTVTQ NGVTTTTYYHFSK |
Molecular weight | 44,96 kDa |
Protein delivered with Tag? | Yes |
Purity estimated | 90% |
Buffer | NaH2PO4 100mM, TrisHCl 10mM, Urea 8M |
Form | liquid |
Delivery condition | Dry Ice |
Delivery lead time in business days | 10-25 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Partial |
Protein Accession | AAK16520.1 |
Spec:SwissProtID | Q9BJL7 |
NCBI Reference | AAK16520.1 |
Aliases /Synonyms | NBL-1-∆Nter, newborn larvae-specific serine protease SS2 |
Reference | PX-P1128 |
Note | For research use only |
Trichinella spiralis is an intracellular parasitic nematode of mammalian skeletal muscle, causing a serious zoonotic disease in humans and showing a high economic impact mainly in pig breeding. Serine proteinases of T. spiralis play important roles in the host–parasite interactions mediating host invasion
Send us a message from the form below
Reviews
There are no reviews yet.