Cart (0 Items)
Your cart is currently empty.
View Products
| Size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Trichinella spiralis NBL-1 Recombinant Protein |
|---|---|
| Uniprot ID | Q9BJL7 |
| Uniprot link | http://www.uniprot.org/uniprot/Q9BJL7 |
| Origin species | Trichinella spiralis |
| Expression system | Prokaryotic expression |
| Sequence | MAHNHRHKHKLAFECGVPHFKPYIWKSGRIVGGTDVRPHSHPWQIQLLKSETGGYSSLCGGSLVHFGKPSNGTRFVLTAA HCITTSNMYPRTSRFTVVTGAHNIKMHEKEKKRIPITSYYVQHWNPVMTTNDIALLRLAETVYYNEYTRPVCLPEPNEEL TPGDICVVTGWGDTTENGTTSNTLKQVGVKIMKKGTCANVRSEVITFCAGAMEGGKDSCQGDSGGPLICKKNGKSVQFGV VSYGTGCARKGYPGVYAKVPSYVTWLNKAAKELENSPEGTVKWASKEDSPVDLSTASRPTNPYTGSRPTSPSSGSRPTYP SSGSRPTSPSSGSRPTYPSSGSRPTYPSSGSRPTYPYTGSRPTPQKPVFPSYQKYPPAVQKYIDSLPSGTQGTLEYTVTQ NGVTTTTYYHFSK |
| Molecular weight | 44,96 kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 90% |
| Buffer | NaH2PO4 100mM, TrisHCl 10mM, Urea 8M |
| Form | liquid |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Partial |
| Protein Accession | AAK16520.1 |
| Spec:SwissProtID | Q9BJL7 |
| NCBI Reference | AAK16520.1 |
| Aliases /Synonyms | NBL-1-∆Nter, newborn larvae-specific serine protease SS2 |
| Reference | PX-P1128 |
| Note | For research use only |
Trichinella spiralis is an intracellular parasitic nematode of mammalian skeletal muscle, causing a serious zoonotic disease in humans and showing a high economic impact mainly in pig breeding. Serine proteinases of T. spiralis play important roles in the host–parasite interactions mediating host invasion
Send us a message from the form below
Reviews
There are no reviews yet.