Cart (0 Items)
Your cart is currently empty.
View Products
| Size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Zika ZGE Recombinant Protein-Genome polyprotein |
|---|---|
| Uniprot ID | A0A140E7U5 |
| Uniprot link | http://www.uniprot.org/uniprot/A0A140E7U5 |
| Origin species | Zika |
| Expression system | Prokaryotic expression |
| Sequence | MIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTAMAQDKPTVDIELVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWGNGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMLVNDTGHETDENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLAHKEWFHDIPLPWHAGAATGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAEMDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETVDGTVTVEGQYGGTDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIIGAAFKLEHHHHHH |
| Molecular weight | 54.6 kDa |
| Purity estimated | 85% |
| Buffer | PBS,pH7.5 |
| Form | Frozen |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Partial |
| Aliases /Synonyms | ZGE, Genome polyprotein |
| Reference | PX-P3065 |
| Note | For research use only |
The genome of Zika virus encodes a single polyprotein that is co- and post-translationally cleaved to generate 13 proteins. For example the peptide pr prevents premature fusion activity of envelope proteins in trans Golgi by binding to envelope protein E at pH6.0. After virion release in extracellular space gets dissociated from E dimers. Non-structural protein 4A induces host endoplasmic regulate the ATPase activity of the NS3 helicase. Non-structural protein 1 is implicated in immune evasion, pathogenesis and viral replication. Once cleaved off the polyprotein is targeted to three destinations: the viral replication cycle, the plasma membrane and the extracellular compartment. It may play a role in viral genome replication etc.
Send us a message from the form below
Reviews
There are no reviews yet.