Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Zika ZGE Recombinant Protein-Genome polyprotein

Host species:
Escherichia coli (E.coli)
Origin species:
Zika
Uniprot ID:
A0A140E7U5
Molecular weight:
54.6 kDa

$250.00

50ug + 250 loyalty points
Partial
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Zika ZGE Recombinant Protein-Genome polyprotein

Product name Zika ZGE Recombinant Protein-Genome polyprotein
Uniprot ID A0A140E7U5
Uniprot link http://www.uniprot.org/uniprot/A0A140E7U5
Origin species Zika
Expression system Prokaryotic expression
Raw Antigen Sequence MIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTAMAQDKPTVDIELVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWGNGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMLVNDTGHETDENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLAHKEWFHDIPLPWHAGAATGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAEMDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETVDGTVTVEGQYGGTDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIIGAAFKLEHHHHHH
Molecular weight 54.6 kDa
Purity estimated 85%
Buffer PBS,pH7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Aliases /Synonyms ZGE, Genome polyprotein
Reference PX-P3065
Note For research use only
Molecular Constructor
Partial
Product name Zika ZGE Recombinant Protein-Genome polyprotein
Uniprot ID A0A140E7U5
Uniprot link http://www.uniprot.org/uniprot/A0A140E7U5
Origin species Zika
Expression system Prokaryotic expression
Raw Antigen Sequence MIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTAMAQDKPTVDIELVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWGNGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMLVNDTGHETDENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLAHKEWFHDIPLPWHAGAATGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAEMDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETVDGTVTVEGQYGGTDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIIGAAFKLEHHHHHH
Molecular weight 54.6 kDa
Purity estimated 85%
Buffer PBS,pH7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Aliases /Synonyms ZGE, Genome polyprotein
Reference PX-P3065
Note For research use only
Molecular Constructor
Partial

General information on Zika ZGE Recombinant Protein/Genome polyprotein

The genome of Zika virus encodes a single polyprotein that is co- and post-translationally cleaved to generate 13 proteins. For example the peptide pr prevents premature fusion activity of envelope proteins in trans Golgi by binding to envelope protein E at pH6.0. After virion release in extracellular space gets dissociated from E dimers. Non-structural protein 4A induces host endoplasmic regulate the ATPase activity of the NS3 helicase. Non-structural protein 1 is implicated in immune evasion, pathogenesis and viral replication. Once cleaved off the polyprotein is targeted to three destinations: the viral replication cycle, the plasma membrane and the extracellular compartment. It may play a role in viral genome replication etc.

Zika ZGE Recombinant Protein-Genome polyprotein

  • "Complete Genome Sequence of Zika Virus from the First Imported Case in Mainland China." Liu L., Wu W., Zhao X., Xiong Y., Zhang S., Liu X., Qu J., Li J., Nei K., Liang M., Shu Y., Hu G., Ma X., Li D. Genome Announc. 4:e00291-16(2016) [PubMed] [Europe PMC] [Abstract]

There are no reviews yet.

Be the first to review “Zika ZGE Recombinant Protein-Genome polyprotein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products