Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Cadherin-1(CDH1)
| Size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Cadherin-1(CDH1) |
|---|---|
| Uniprot ID | P12830 |
| Uniprot link | https://www.uniprot.org/uniprot/P12830 |
| Expression system | Prokaryotic expression |
| Sequence | DWVIPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAAIAYTILSQDPELPDKNMFTINRNTGVISVVTTGLDRESFPAYTLVVQAADLQGEGLSTTATAVITVTD |
| Molecular weight | 23.11 kDa |
| Protein delivered with Tag? | N-terminal His Tag |
| Purity estimated | >90%by SDS-PAGE |
| Buffer | PBS pH 7.5, 0.02% SKL |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Asp155-Asp367 |
| Protein Accession | P12830 |
| Spec:Entrez GeneID | 999 |
| Spec:NCBI Gene Aliases | UVO; CDHE; ECAD; LCAM; Arc-1; BCDS1; CD324 |
| Spec:SwissProtID | Q13799 |
| NCBI Reference | P12830 |
| Aliases /Synonyms | CAM 120/80,Epithelial cadherin,E-cadherin,Uvomorulin,CD_antigen: CD324,CDHE, UVO |
| Reference | PX-P4709 |
| Note | For research use only |
Related products
Biosimilar
Duvortuxizumab Biosimilar – Anti-CD19, CD3E mAb – Research Grade
PX-TA1432 238$
Biosimilar
Tuvonralimab Biosimilar – Anti-CTLA4 mAb – Research Grade
PX-TA1781 440$
Biosimilar
Semzuvolimab Biosimilar – Anti-CD4 mAb – Research Grade
PX-TA1883 238$
Tag Antibody
Anti His tag mouse monoclonal antibody
PTX17851 215$Contact us
Send us a message from the form below
Reviews
There are no reviews yet.