Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | Cadherin-1(CDH1) |
---|---|
Uniprot ID | P12830 |
Uniprot link | https://www.uniprot.org/uniprot/P12830 |
Expression system | Prokaryotic expression |
Sequence | DWVIPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAAIAYTILSQDPELPDKNMFTINRNTGVISVVTTGLDRESFPAYTLVVQAADLQGEGLSTTATAVITVTD |
Molecular weight | 23.11 kDa |
Protein delivered with Tag? | N-terminal His Tag |
Purity estimated | >90%by SDS-PAGE |
Buffer | PBS pH 7.5, 0.02% SKL |
Delivery condition | Dry Ice |
Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Asp155-Asp367 |
Protein Accession | P12830 |
Spec:Entrez GeneID | 999 |
Spec:NCBI Gene Aliases | UVO; CDHE; ECAD; LCAM; Arc-1; BCDS1; CD324 |
Spec:SwissProtID | Q13799 |
NCBI Reference | P12830 |
Aliases /Synonyms | CAM 120/80,Epithelial cadherin,E-cadherin,Uvomorulin,CD_antigen: CD324,CDHE, UVO |
Reference | PX-P4709 |
Note | For research use only |
Related products
Send us a message from the form below
Reviews
There are no reviews yet.