Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Mammalian cells |
Applications | Elisa, WB |
Product name | CD137 Recombinant Protein |
---|---|
Uniprot ID | Q07011 |
Uniprot link | http://www.uniprot.org/uniprot/Q07011 |
Origin species | Homo sapiens (Human) |
Expression system | Eukaryotic expression |
Sequence | MGNSCYNIVATLLLVLNFERTRSLQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ |
Molecular weight | 30kDa |
Protein delivered with Tag? | C-terminal His Tag |
Purity estimated | >90% by SDS-PAGE |
Buffer | PBS pH7.5 |
Delivery condition | Dry Ice |
Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. |
Brand | ProteoGenix |
Host species | Mammalian cells |
Fragment Type | Met1~Gln186 |
Aliases /Synonyms | CD137, ILA,4-1BB |
Reference | PX-P4107 |
Note | For research use only |
CD137 (also known as 4-1BB) is a co-stimulating surface glycoprotein originally described as a co-stimulating surface glycoprotein present in activated T lymphocytes, which belongs to the tumor necrosis factor (TNF) receptor superfamily. It is expressed mainly in CD4 + and CD8 + activated T cells and binds to high affinity ligands (4-1BBL) expressed in some antigen presenting cells (such as macrophages and activated B cells). 4-1BB is related to factors related to tumor receptor necrosis (TRAFs), which are adaptive proteins that mediate guided signaling events (including NF-κB activation and cytokine production). Transmission of the 4-1BB signal via binding to 4-1BBL or via antibody binding can transmit T cell activation and growth, monocyte proliferation and B cell survival signals, and play an important role in immune amplification mediated by T cells. In addition, CD137 and CD137L are expressed in different tissues of primary human tumor, indicating that they can affect tumor progression. Crosslinking of CD137 to activated T cells has demonstrated the potential to improve the antitumor immune response in the wall model, and anti-CD137 agonist antibodies are currently being tested in phase clinical trials. The soluble form of CD137 (sCD137) is produced by differential splicing. sCD137 can bind to the CD137 ligand to antagonize the membrane-co-stimulating CD137 activity and reduce T-cell proliferation and IL-2 secretion.
Send us a message from the form below
Reviews
There are no reviews yet.