Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tecaginlimab Biosimilar – Anti-CD40 & CD137 mAb – Research Grade

  • PX-TA1777-50
  • Validated FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $225.00.Current price is: $167.00.

50ug 26% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Tecaginlimab Biosimilar - Anti-CD40 & CD137 mAb - Research Grade

Product name Tecaginlimab Biosimilar - Anti-CD40 & CD137 mAb - Research Grade
Uniprot ID P25942 & Q07011
Source CAS: 2253891-70-0
Species Humanized
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Tecaginlimab,BNT-312, DuoBody-CD40x-4-1BB, GEN 1042, GEN-1042, GEN1042,CD40 & CD137,anti-CD40 & CD137
Reference PX-TA1777
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Tecaginlimab Biosimilar - Anti-CD40 & CD137 mAb - Research Grade
Uniprot ID P25942 & Q07011
Source CAS: 2253891-70-0
Species Humanized
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Tecaginlimab,BNT-312, DuoBody-CD40x-4-1BB, GEN 1042, GEN-1042, GEN1042,CD40 & CD137,anti-CD40 & CD137
Reference PX-TA1777
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1777-50
Uniprot ID P25942 & Q07011
Source CAS: 2253891-70-0
Species Humanized
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Tecaginlimab,BNT-312, DuoBody-CD40x-4-1BB, GEN 1042, GEN-1042, GEN1042,CD40 & CD137,anti-CD40 & CD137
Reference PX-TA1777
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction to Tecaginlimab Biosimilar – Anti-CD40 & CD137 mAb

Tecaginlimab Biosimilar, also known as anti-CD40 & CD137 mAb, is a novel therapeutic antibody that targets two important immune checkpoints, CD40 and CD137. This biosimilar is designed to mimic the activity of the original antibody, while also providing cost-effective treatment options for patients. In this article, we will discuss the structure, activity, and potential applications of Tecaginlimab Biosimilar as a research grade antibody.

Structure of Tecaginlimab Biosimilar

Tecaginlimab Biosimilar is a monoclonal antibody that is produced by recombinant DNA technology. It is a fully humanized antibody, meaning that it is derived from human cells and has a high degree of similarity to the original antibody. The antibody has a molecular weight of approximately 150 kDa and is composed of two identical heavy chains and two identical light chains. These chains are linked together by disulfide bonds and form the basic Y-shaped structure of an antibody.

The variable region of Tecaginlimab Biosimilar is responsible for its specificity and binding to the target receptors, CD40 and CD137. This region is located at the tips of the Y-shaped structure and is highly diverse, allowing the antibody to recognize and bind to its target with high affinity.

Activity of Tecaginlimab Biosimilar

Tecaginlimab Biosimilar is a dual-targeting antibody that binds to both CD40 and CD137 receptors. CD40 is a cell surface receptor that is primarily expressed on antigen-presenting cells, such as dendritic cells, B cells, and macrophages. It plays a crucial role in activating immune responses, including the production of cytokines and the differentiation of T cells.

CD137, also known as 4-1BB, is another cell surface receptor that is mainly expressed on activated T cells and natural killer cells. It is involved in the regulation of immune responses and has been shown to enhance the proliferation and survival of T cells.

By targeting both CD40 and CD137, Tecaginlimab Biosimilar can modulate immune responses in multiple ways. It can enhance the activation and proliferation of T cells, which are crucial for mounting an effective immune response against pathogens and cancer cells. It can also promote the production of cytokines, which play a crucial role in coordinating immune responses.

Applications of Tecaginlimab Biosimilar

Tecaginlimab Biosimilar has potential applications in various fields of research, including immunology, oncology, and infectious diseases. As a research grade antibody, it can be used to study the role of CD40 and CD137 in immune responses and their potential as therapeutic targets.

In oncology, Tecaginlimab Biosimilar has shown promising results in preclinical studies as a potential treatment for various types of cancer. By targeting CD40 and CD137, it can enhance the anti-tumor immune response and inhibit the growth of cancer cells.

In infectious diseases, Tecaginlimab Biosimilar has the potential to boost the immune response against pathogens, making it a potential treatment option for viral and bacterial infections.

Conclusion

Tecaginlimab Biosimilar – Anti-CD40 & CD137 mAb – Research Grade is a novel therapeutic antibody that targets two important immune checkpoints, CD40 and CD137. Its structure, activity, and potential applications make it a valuable tool for research in immunology, oncology, and infectious diseases. As a biosimilar, it provides a cost-effective alternative to the original antibody, making it more accessible to researchers and potentially to patients in the future.

SDS-PAGE for Tecaginlimab Biosimilar - Anti-CD40 &, CD137 mAb - Research Grade

SDS-PAGE for Tecaginlimab Biosimilar - Anti-CD40 &amp, CD137 mAb - Research Grade

Tecaginlimab Biosimilar - Anti-CD40 &, CD137 mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Flow Cytometry results for Tecaginlimab Biosimilar - Anti-CD40 &, CD137 mAb - Research Grade

Flow Cytometry results for Tecaginlimab Biosimilar - Anti-CD40 &amp, CD137 mAb - Research Grade

Flow-cytometry using PE anti-human CD40 antibody. U2OS cells were stained with an irrelevant antibody (Blue Histogram) or an PE anti-human CD40 monoclonal antibody (Catalog: PX-TA1777, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, and cells analysed on a NovoCyte Flow Cytometer.

Tecaginlimab Biosimilar - Anti-CD40 & CD137 mAb - Research Grade

There are no reviews yet.

Be the first to review “Tecaginlimab Biosimilar – Anti-CD40 & CD137 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products