Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

CD137 Recombinant Protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q07011
Molecular weight:
30kDa

$380.00

100ug + 380 loyalty points
Met1~Gln186 His
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

CD137 Recombinant Protein

Product name CD137 Recombinant Protein
Uniprot ID Q07011
Uniprot link http://www.uniprot.org/uniprot/Q07011
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MGNSCYNIVATLLLVLNFERTRSLQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ
Molecular weight 30kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1~Gln186
Aliases /Synonyms CD137, ILA,4-1BB
Reference PX-P4107
Note For research use only
Molecular Constructor
Met1~Gln186 His

General information on CD137 Recombinant Protein:

CD137 (also known as 4-1BB) is a co-stimulating surface glycoprotein originally described as a co-stimulating surface glycoprotein present in activated T lymphocytes, which belongs to the tumor necrosis factor (TNF) receptor superfamily. It is expressed mainly in CD4 + and CD8 + activated T cells and binds to high affinity ligands (4-1BBL) expressed in some antigen presenting cells (such as macrophages and activated B cells). 4-1BB is related to factors related to tumor receptor necrosis (TRAFs), which are adaptive proteins that mediate guided signaling events (including NF-κB activation and cytokine production). Transmission of the 4-1BB signal via binding to 4-1BBL or via antibody binding can transmit T cell activation and growth, monocyte proliferation and B cell survival signals, and play an important role in immune amplification mediated by T cells. In addition, CD137 and CD137L are expressed in different tissues of primary human tumor, indicating that they can affect tumor progression. Crosslinking of CD137 to activated T cells has demonstrated the potential to improve the antitumor immune response in the wall model, and anti-CD137 agonist antibodies are currently being tested in phase clinical trials. The soluble form of CD137 (sCD137) is produced by differential splicing. sCD137 can bind to the CD137 ligand to antagonize the membrane-co-stimulating CD137 activity and reduce T-cell proliferation and IL-2 secretion.

Urelumab Biosimilar - Anti-TNFRSF9, CD137 mAb binds to CD137 Recombinant Protein in indirect ELISA Assay

Urelumab Biosimilar - Anti-TNFRSF9, CD137 mAb binds to CD137 Recombinant Protein in indirect ELISA Assay

Immobilized CD137 Recombinant Protein (cat. No.PX-P4107) at 0.5µg/mL (100µL/well) can bind to Urelumab Biosimilar - Anti-TNFRSF9, CD137 mAb (cat. No.PX-TA1265) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Utomilumab Biosimilar - Anti-Human TNFRSF9 mAb binds to CD137 Recombinant Protein in indirect ELISA Assay

Utomilumab Biosimilar - Anti-Human TNFRSF9 mAb binds to CD137 Recombinant Protein in indirect ELISA Assay

Immobilized CD137 Recombinant Protein (cat. No.PX-P4107) at 0.5µg/mL (100µL/well) can bind to Utomilumab Biosimilar - Anti-Human TNFRSF9 mAb (cat. No.PX-TA1012) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

There are no reviews yet.

Be the first to review “CD137 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products