Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
CD40 ligand(CD40LG)
| Size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | CD40 ligand(CD40LG) |
|---|---|
| Uniprot ID | P29965 |
| Uniprot link | https://www.uniprot.org/uniprot/P29965 |
| Expression system | Prokaryotic expression |
| Sequence | MENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLTVKRQGLYYIYAQVTFCSNREASSQ APFIASLCLKSPGRFERILLRAANTHSSAKPCGQQSIHLGGVFELQPGASVFVNVTDPSQVSHGTGFTSFGLLKLLEHHH HHH |
| Molecular weight | 18kDa |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >80% by SDS-PAGE |
| Buffer | PBS, pH7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Glu108-Leu261 |
| Protein Accession | P29965 |
| Spec:Entrez GeneID | 959 |
| Spec:NCBI Gene Aliases | IGM; IMD3; TRAP; gp39; CD154; CD40L; HIGM1; T-BAM; TNFSF5; hCD40L |
| NCBI Reference | P29965 |
| Aliases /Synonyms | CD40-L,T-cell antigen Gp39,TNF-related activation protein,TRAP,Tumor necrosis factor ligand superfamily member 5,CD_antigen: CD154,CD40L, TNFSF5, TRAP |
| Reference | PX-P4855 |
| Note | For research use only |
Related products
Biosimilar
Ruplizumab Biosimilar – Anti-CD40LG mAb – Research Grade
PX-TA1036 238$
Biosimilar
Dapirolizumab Biosimilar – Anti-CD40LG, CD154 mAb – Research Grade
PX-TA1337 238$
Biosimilar
Letolizumab Biosimilar – Anti-CD40LG, CD154 mAb – Research Grade
PX-TA1459 238$
Biosimilar
Frexalimab Biosimilar – Anti-CD40LG mAb – Research Grade
PX-TA1842 238$
Biosimilar
Toralizumab Biosimilar – Anti-sCD40L mAb – Research Grade
PX-TA1925 238$
Tag Antibody
Anti His tag mouse monoclonal antibody
PTX17851 215$Contact us
Send us a message from the form below
Reviews
There are no reviews yet.