Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Mammalian cells |
Applications | Elisa, WB |
Product name | CD83 Recombinant Protein |
---|---|
Uniprot ID | Q01151 |
Uniprot link | http://www.uniprot.org/uniprot/Q01151 |
Origin species | Homo sapiens (Human) |
Expression system | Eukaryotic expression |
Sequence | MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA |
Molecular weight | 15-25kDa |
Protein delivered with Tag? | C-terminal His Tag |
Purity estimated | >90% by SDS-PAGE |
Buffer | PBS pH7.5 |
Delivery condition | Dry Ice |
Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. |
Brand | ProteoGenix |
Host species | Mammalian cells |
Fragment Type | Met1-Ala143 |
Aliases /Synonyms | CD83 |
Reference | PX-P4092 |
Note | For research use only |
The CD83 antigen is also known as the B cell activating protein and the HB15 cell surface protein. CD83 is a single-passage type I membrane protein that contains an Ig-type (immunoglobulin-like) type V domain. CD83 is expressed by activated lymphocytes, Langerhans cells and reticular cells of the fingers. CD83 may play an important role in antigen presentation or in cellular interaction after lymphocyte activity.
Send us a message from the form below
Reviews
There are no reviews yet.