Skip to main content

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

CD83 Recombinant Protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q01151
Molecular weight:
15-25kDa

$380.00

100ug + 380 loyalty points
Met1–Ala143 His
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

CD83 Recombinant Protein

Product name CD83 Recombinant Protein
Uniprot ID Q01151
Uniprot link http://www.uniprot.org/uniprot/Q01151
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA
Molecular weight 15-25kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Ala143
Aliases /Synonyms CD83
Reference PX-P4092
Note For research use only
Background information Array
Molecular Constructor
Met1–Ala143 His

General information on CD83 Recombinant Protein:

The CD83 antigen is also known as the B cell activating protein and the HB15 cell surface protein. CD83 is a single-passage type I membrane protein that contains an Ig-type (immunoglobulin-like) type V domain. CD83 is expressed by activated lymphocytes, Langerhans cells and reticular cells of the fingers. CD83 may play an important role in antigen presentation or in cellular interaction after lymphocyte activity.

There are no reviews yet.

Be the first to review “CD83 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products