Name: FAS Protein- Human Factor Related Apoptosis Recombinant protein
SKU: PX-P4017-10
Availability: InStock

size	100ug, 50ug
Brand	ProteoGenix
Product type	Recombinant Proteins
Host Species	Mammalian cells
Applications	Elisa, WB

Signal Transduction Immunology Cancer

Product name	FAS Protein- Human Factor Related Apoptosis Recombinant protein
Uniprot ID	P25445
Uniprot link	http://www.uniprot.org/uniprot/P25445
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Sequence	MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNGSHHHHHH
Molecular weight	20,22 kDa
Protein delivered with Tag?	Yes
Purity estimated	80%
Buffer	50 mM Tris-HCl, pH 8.0, 150 mM NaCl
Form	Lyophilized
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	FAS protein is stored: At 4°C for short term period (less than a week) At -20°C or -80°C for long term period Recommendations It is important to avoid avoid freezing/thawing cycles 20-40% glycerol may be added to improve cryoprotection
Brand	ProteoGenix
Host species	Mammalian cells
Applications	ELISA,WB
Fragment Type	Partial
Aliases /Synonyms	ALPS 1A, ALPS1A, APO 1, Apo 1 antigen, APO 1 cell surface antigen, Apo-1 antigen, APO1, Apo1 antigen, APO1 cell surface antigen, Apoptosis antigen 1, Apoptosis mediating surface antigen FAS, Apoptosis-mediating surface antigen FAS, APT 1, APT1, CD 95, CD 95 antigen, CD95, CD95 antigen, Delta Fas, Delta Fas/APO 1/CD95, Delta Fas/APO1/CD95, Fas, Fas (TNF receptor superfamily, member 6), FAS 1, FAS 827dupA, Fas AMA, FAS Antigen, Fas cell surface death receptor, FAS1, FASLG receptor, FASTM, sFAS, Surface antigen APO1, TNF receptor superfamily, member 6, TNFRSF 6, TNFRSF6, TNR6_HUMAN, Tumor necrosis factor receptor superfamily member 6
Reference	PX-P4017
Note	For research use only