Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Mammalian cells |
Applications | Elisa, WB |
Product name | Granulocyte-macrophage colony-stimulating factor receptor subunit alpha(CSF2RA) |
---|---|
Uniprot ID | P15509 |
Uniprot link | https://www.uniprot.org/uniprot/P15509 |
Origin species | Homo sapiens (Human) |
Expression system | Eukaryotic expression |
Sequence | MLLLVTSLLLCELPHPAFLLIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDG |
Molecular weight | 60 kDa(36.91 kDa) |
Protein delivered with Tag? | C-terminal His Tag |
Purity estimated | >95% by SDS-PAGE |
Buffer | PBS, pH7.5 |
Delivery condition | Dry Ice |
Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Mammalian cells |
Fragment Type | Met1-Gly320 |
Protein Accession | P15509 |
Spec:Entrez GeneID | 1438 |
Spec:NCBI Gene Aliases | GMR; CD116; CSF2R; SMDP4; CDw116; CSF2RX; CSF2RY; GMCSFR; CSF2RAX; CSF2RAY; alphaGMR; GMR-alpha; GMCSFR-alpha; GM-CSF-R-alpha |
Spec:SwissProtID | Q16564 |
NCBI Reference | P15509 |
Aliases /Synonyms | CSF2R, CSF2RY,GM-CSF-R-alpha,GMCSFR-alpha,GMR-alpha,CDw116,CD116 |
Reference | PX-P4584 |
Note | For research use only |
Related products
Send us a message from the form below
Reviews
There are no reviews yet.