Cart (0 Items)
Your cart is currently empty.
View Productssize | 10ug, 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Mammalian cells |
Applications | Elisa, WB |
Product name | Human CD28 recombinant protein |
---|---|
Uniprot ID | P10747 |
Uniprot link | http://www.uniprot.org/uniprot/P10747 |
Origin species | Homo sapiens (Human) |
Expression system | Eukaryotic expression |
Sequence | MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPDKTHTCPPCPAPELLGGPSVFLFPPKPKDQLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHNHYTQKSLSLSPGK |
Molecular weight | 42.63kDa |
Protein delivered with Tag? | Yes |
Purity estimated | 70% |
Buffer | PBS, pH 7.5 |
Form | Lyophilized |
Delivery condition | Dry Ice |
Delivery lead time in business days | 5-7 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Mammalian cells |
Fragment Type | Partial |
Aliases /Synonyms | CD28, T-cell-specific surface glycoprotein CD28, Tp44, T-Cell-Specific Surface Glycoprotein, MGC138290 |
Reference | PX-P4044 |
Note | For research use only |
CD28 (Cluster of differentiation 28) is a disulfide-linked glycoprotein which belongs to the immunoglobulin (Ig) superfamily. It consists of a single Ig V-like extracellular domain, transmembrane domain and intracellular domain in the structure. composition. Mouse CD28 is structurally expressed on the surface of all parietal cells and is expressed by developing thymocytes into disulfide-bound homodimers or monomers. CD28 can bind to B7-1 and B7-2 ligands and together play an important role in T and B lymphocyte response. Members of the B7 / CD28 family can enhance or antagonize T cell receptor signal transduction and tolerance of peripheral cells according to central regulation. Thus, CD28 is involved in the activation of T cells, the induction of cell proliferation, the production of cytokines and the acceleration of T cell survival.
Related products
Send us a message from the form below
Reviews
There are no reviews yet.