Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | Human T-cell surface glycoprotein CD3 epsilon chain (CD3E) recombinant protein |
|---|---|
| Uniprot ID | P07766 |
| Uniprot link | http://www.uniprot.org/uniprot/P07766 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDGSHHHHHH |
| Molecular weight | 15.09kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 60% |
| Buffer | 50 mM Tris-HCl, pH 8.0, 150 mM NaCl |
| Form | Lyophilized |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 5-7 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Partial |
| Aliases /Synonyms | CD3E, T3E, TCRE, CD3-E Molecule,Epsilon(CD3-TCR Complex), T-cell surface antigen T3/Leu-4 epsilon chain |
| Reference | PX-P4014 |
| Note | For research use only |
Related products
Send us a message from the form below
Reviews
There are no reviews yet.