Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Human Tumor necrosis factor receptor superfamily member 1A (TNFR1A) recombinant protein
| Size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | Human Tumor necrosis factor receptor superfamily member 1A (TNFR1A) recombinant protein |
|---|---|
| Uniprot ID | P19438 |
| Uniprot link | http://www.uniprot.org/uniprot/P19438 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTTGSHHHHHH |
| Molecular weight | 24.35kDa |
| Purity estimated | 90% |
| Buffer | 50 mM Tris-HCl pH 8, 150 mM NaCl |
| Form | Lyophilized |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 5-7 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Partial |
| Aliases /Synonyms | CD120A, P55, TBP1, FPF, TNF-R, TNF-R-I, TNF-R55, TNFAR, TNFR1, TNFR55, TNFR60, P55-R, P60, Tumor necrosis factor receptor 1, Tumor necrosis factor-binding protein 1 |
| Reference | PX-P4037 |
| Note | For research use only |
Related products
Contact us
Send us a message from the form below
Reviews
There are no reviews yet.