Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | ICOSL Protein- Human ICOS ligand recombinant protein- CD278 Protein |
|---|---|
| Uniprot ID | O75144 |
| Uniprot link | http://www.uniprot.org/uniprot/O75144 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSGSHHHHHH |
| Molecular weight | 29.56kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 90% |
| Buffer | 50 mM Tris-HCl pH 8, 150 mM NaCl |
| Form | Lyophilized |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | ICOSL protein is stored:At 4°C for short term period (less than a week) At -20°C or -80°C for long term period RecommendationsIt is important to avoid avoid freezing/thawing cycles 20-40% glycerol may be added to improve cryoprotection |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Partial |
| Aliases /Synonyms | CD275, B7-H2, B7H2, B7RP-1, B7RP1, GL50, ICOS-L, ICOSL, LICOS, B7-like protein Gl50, B7-related protein 1 |
| Reference | PX-P4032 |
| Note | For research use only |
ICOSL Protein- Human ICOS ligand recombinant protein- CD278 Protein, on SDS-PAGE under reducing
Related products
Send us a message from the form below
Reviews
There are no reviews yet.