Name: Leishmania tropica TSA Recombinant Protein
SKU: PX-P1165-10
Availability: InStock

Product name	Leishmania tropica TSA Recombinant Protein
Uniprot ID	Q07DU5
Uniprot link	http://www.uniprot.org/uniprot/Q07DU5
Origin species	Leishmania tropica
Expression system	Prokaryotic expression
Sequence	MAHNHRHKHKLMSCGNAKINSPAPPFEEVALMPNGSFKKISLSAYKGKWVVLFFYPLDFSFVCPTEIIAFSDNVSRFNEL NCEVLACSMDSEYAHLQWTLQDRKKGGLGAMAIPMLADKTKSIARSYGVLEESQGVAYRGLFIIDPHGMVRQITVNDMPV GRNVEEVLRLLEAFQFVEKHGEVCPANWKKGAPAMKPEPNASVEGYFSKQ
Molecular weight	23,47 kDa
Protein delivered with Tag?	Yes
Purity estimated	90%
Buffer	PBS, imidazole 300mM
Form	liquid
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Full-length
Spec:SwissProtID	Q07DU5
NCBI Reference	AAZ23601.1
Aliases /Synonyms	TSA, Peroxidoxin 2 / Thiol-specific Antioxidant Antigen (TSA)
Reference	PX-P1165
Note	For research use only

No Products found