Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Mouse Interleukin-12 subunit beta(Il12b)
| Size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | Mouse Interleukin-12 subunit beta(Il12b) |
|---|---|
| Uniprot ID | P43432 |
| Uniprot link | https://www.uniprot.org/uniprot/P43432 |
| Origin species | House Mouse |
| Expression system | Eukaryotic expression |
| Sequence | MCPQKLTISWFAIVLLVSPLMAMWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS |
| Molecular weight | 42-50kDa |
| Protein delivered with Tag? | C-terminal Twin-Strep tag |
| Purity estimated | >95% by SDS-PAGE |
| Buffer | PBS pH 7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Met1-Ser335 |
| Protein Accession | P43432 |
| Spec:Entrez GeneID | 16160 |
| Spec:NCBI Gene Aliases | p40; Il-1; Il-12; Il-12b; Il12p40; Il-12p40 |
| Spec:SwissProtID | Q9QUM1 |
| NCBI Reference | P43432 |
| Aliases /Synonyms | Cytotoxic lymphocyte maturation factor 40 kDa subunit；CLMF p40；IL-12 subunit p40 |
| Reference | PX-P4571 |
| Note | For research use only |
Related products
Biosimilar
Briakinumab Biosimilar – Anti-IL12B mAb – Research Grade
PX-TA1118 238$
Biosimilar
Ebdarokimab Biosimilar – Anti-IL12B mAb – Research Grade
PX-TA1660 238$Contact us
Send us a message from the form below
Reviews
There are no reviews yet.