Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Briakinumab Biosimilar – Anti-IL12B mAb – Research Grade

  • PX-TA1118-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, lambda

Original price was: $225.00.Current price is: $167.00.

50ug 26% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Briakinumab Biosimilar - Anti-IL12B mAb - Research Grade

Product name Briakinumab Biosimilar - Anti-IL12B mAb - Research Grade
Uniprot ID P29460
Source CAS 339308-60-0
Species Homo sapiens
Raw Antigen Sequence MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Molecular weight 147kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Briakinumab,ABT-874,J695,LDP-01,MLNM2201,IL12B,anti-IL12B
Reference PX-TA1118
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name Briakinumab Biosimilar - Anti-IL12B mAb - Research Grade
Uniprot ID P29460
Source CAS 339308-60-0
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Molecular weight 147kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Briakinumab,ABT-874,J695,LDP-01,MLNM2201,IL12B,anti-IL12B
Reference PX-TA1118
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name PX-TA1118-50
Uniprot ID P29460
Source CAS 339308-60-0
Species Homo sapiens
Raw Antigen Sequence MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Molecular weight 147kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Briakinumab,ABT-874,J695,LDP-01,MLNM2201,IL12B,anti-IL12B
Reference PX-TA1118
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, lambda
Clonality Monoclonal Antibody

Briakinumab Biosimilar – Anti-IL12B mAb – Research Grade: A Promising Antibody for Targeting IL12B in Therapeutic Applications Briakinumab Biosimilar – Anti-IL12B mAb – Research Grade: A Promising Antibody for Targeting IL12B in Therapeutic Applications Briakinumab Biosimilar is a monoclonal antibody (mAb) that specifically targets interleukin-12B (IL12B), a cytokine involved in immune response and inflammation. This biosimilar is a highly promising therapeutic agent due to its structural and functional similarities to the approved biologic drug, briakinumab, and its potential for treating various inflammatory and autoimmune diseases.

Structure of Briakinumab Biosimilar

Briakinumab Biosimilar is a recombinant humanized IgG1 monoclonal antibody produced in Chinese hamster ovary (CHO) cells. It consists of two identical heavy chains and two identical light chains, each with a molecular weight of approximately 50 kDa. The antibody has a typical Y-shaped structure with two antigen-binding Fab regions and one Fc region responsible for effector functions.

The amino acid sequence and glycosylation pattern of Briakinumab Biosimilar are highly similar to that of the reference biologic drug, briakinumab. This ensures its comparable safety and efficacy profiles, making it a reliable alternative to the original product.

Mechanism of Action

Briakinumab Biosimilar binds specifically to IL12B, a subunit of the interleukin-12 (IL-12) cytokine, which plays a crucial role in regulating the immune response. IL-12 is primarily produced by antigen-presenting cells and acts on T cells and natural killer cells to induce the production of interferon-gamma (IFN-γ) and other pro-inflammatory cytokines.

By binding to IL12B, Briakinumab Biosimilar prevents the interaction of IL-12 with its receptor, thereby inhibiting the downstream signaling pathways and reducing the production of pro-inflammatory cytokines. This leads to a decrease in inflammation and immune response, making it a potential therapeutic option for various inflammatory and autoimmune conditions.

Applications of Briakinumab Biosimilar

Briakinumab Biosimilar is currently being evaluated in clinical trials for the treatment of psoriasis, psoriatic arthritis, and Crohn’s disease. These conditions are characterized by an overactive immune response, and targeting IL12B with Briakinumab Biosimilar has shown promising results in reducing disease severity and improving symptoms.

Moreover, preclinical studies have also shown the potential of Briakinumab Biosimilar in other inflammatory and autoimmune diseases, such as rheumatoid arthritis, multiple sclerosis, and ulcerative colitis. These findings suggest a broad range of therapeutic applications for this biosimilar in the future.

Conclusion

Briakinumab Biosimilar is a highly promising antibody that specifically targets IL12B, a key cytokine involved in immune response and inflammation. Its structural and functional similarities to the approved biologic drug, briakinumab, make it a reliable alternative with comparable safety and efficacy profiles. With ongoing clinical trials and potential for treating various inflammatory and autoimmune diseases, Briakinumab Biosimilar holds great promise as a therapeutic agent for improving patient outcomes.

SDS-PAGE for Briakinumab Biosimilar - Anti-IL12B mAb - Research Grade

SDS-PAGE for Briakinumab Biosimilar - Anti-IL12B mAb - Research Grade

Briakinumab Biosimilar - Anti-IL12B mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Briakinumab Biosimilar - Anti-IL12B mAb - Research Grade in ELISA Assay

Briakinumab Biosimilar - Anti-IL12B mAb - Research Grade in ELISA Assay

Briakinumab Biosimilar - Anti-IL12B mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Briakinumab Biosimilar - Anti-IL12B mAb - Research Grade

There are no reviews yet.

Be the first to review “Briakinumab Biosimilar – Anti-IL12B mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products