Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mouse Interleukin-12 subunit beta(Il12b)

Host species:
Mammalian cells
Origin species:
House Mouse
Uniprot ID:
P43432
Molecular weight:
42-50kDa

Original price was: $370.00.Current price is: $308.00.

50ug 17% OFF + 308 loyalty points
Met1–Ser335 Twin-Strep
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Mouse Interleukin-12 subunit beta(Il12b)

Product name Mouse Interleukin-12 subunit beta(Il12b)
Uniprot ID P43432
Uniprot link https://www.uniprot.org/uniprot/P43432
Origin species House Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MCPQKLTISWFAIVLLVSPLMAMWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS
Molecular weight 42-50kDa
Protein delivered with Tag? C-terminal Twin-Strep tag
Purity estimated >95% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Ser335
Protein Accession P43432
Spec:Entrez GeneID 16160
Spec:NCBI Gene Aliases p40; Il-1; Il-12; Il-12b; Il12p40; Il-12p40
Spec:SwissProtID Q9QUM1
NCBI Reference P43432
Aliases /Synonyms Cytotoxic lymphocyte maturation factor 40 kDa subunit;CLMF p40;IL-12 subunit p40
Reference PX-P4571
Note For research use only
Molecular Constructor
Met1–Ser335 Twin-Strep
Product name Mouse Interleukin-12 subunit beta(Il12b)
Uniprot ID P43432
Uniprot link https://www.uniprot.org/uniprot/P43432
Origin species House Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MCPQKLTISWFAIVLLVSPLMAMWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS
Molecular weight 42-50kDa
Protein delivered with Tag? C-terminal Twin-Strep tag
Purity estimated >95% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Ser335
Protein Accession P43432
Spec:Entrez GeneID 16160
Spec:NCBI Gene Aliases p40; Il-1; Il-12; Il-12b; Il12p40; Il-12p40
Spec:SwissProtID Q9QUM1
NCBI Reference P43432
Aliases /Synonyms Cytotoxic lymphocyte maturation factor 40 kDa subunit;CLMF p40;IL-12 subunit p40
Reference PX-P4571
Note For research use only
Molecular Constructor
Met1–Ser335 Twin-Strep
Product name PX-P4571-1MG
Uniprot ID P43432
Uniprot link https://www.uniprot.org/uniprot/P43432
Origin species House Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MCPQKLTISWFAIVLLVSPLMAMWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS
Molecular weight 42-50kDa
Protein delivered with Tag? C-terminal Twin-Strep tag
Purity estimated >95% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Ser335
Protein Accession P43432
Spec:Entrez GeneID 16160
Spec:NCBI Gene Aliases p40; Il-1; Il-12; Il-12b; Il12p40; Il-12p40
Spec:SwissProtID Q9QUM1
NCBI Reference P43432
Aliases /Synonyms Cytotoxic lymphocyte maturation factor 40 kDa subunit;CLMF p40;IL-12 subunit p40
Reference PX-P4571
Note For research use only
Molecular Constructor
Met1–Ser335 Twin-Strep

Mouse Interleukin-12 subunit beta(Il12b)

There are no reviews yet.

Be the first to review “Mouse Interleukin-12 subunit beta(Il12b)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products