Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mouse Interleukin-18(Il18)

Host species:
Mammalian cells
Origin species:
House Mouse
Uniprot ID:
P70380
Molecular weight:
46.12kDa

Original price was: $313.00.Current price is: $250.00.

50ug 20% OFF + 250 loyalty points
Met1–Ser192 Fc
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Mouse Interleukin-18(Il18)

Product name Mouse Interleukin-18(Il18)
Uniprot ID P70380
Uniprot link https://www.uniprot.org/uniprot/P70380
Origin species House Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MAAMSEDSCVNFKEMMFIDNTLYFIPEENGDLESDNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS
Molecular weight 46.12kDa
Protein delivered with Tag? C-terminal Fc Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Ser192
Protein Accession P70380
Spec:Entrez GeneID 16173
Spec:NCBI Gene Aliases Ig; Il-; Igif; Il-18
NCBI Reference P70380
Aliases /Synonyms IL-18,Interferon gamma-inducing factor,IFN-gamma-inducing factor,Interleukin-1 gamma,IL-1 gamma,Igif
Reference PX-P4661
Note For research use only
Molecular Constructor
Met1–Ser192 Fc
Product name Mouse Interleukin-18(Il18)
Uniprot ID P70380
Uniprot link https://www.uniprot.org/uniprot/P70380
Origin species House Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MAAMSEDSCVNFKEMMFIDNTLYFIPEENGDLESDNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS
Molecular weight 46.12kDa
Protein delivered with Tag? C-terminal Fc Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Ser192
Protein Accession P70380
Spec:Entrez GeneID 16173
Spec:NCBI Gene Aliases Ig; Il-; Igif; Il-18
NCBI Reference P70380
Aliases /Synonyms IL-18,Interferon gamma-inducing factor,IFN-gamma-inducing factor,Interleukin-1 gamma,IL-1 gamma,Igif
Reference PX-P4661
Note For research use only
Molecular Constructor
Met1–Ser192 Fc
Product name PX-P4661-1MG
Uniprot ID P70380
Uniprot link https://www.uniprot.org/uniprot/P70380
Origin species House Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MAAMSEDSCVNFKEMMFIDNTLYFIPEENGDLESDNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS
Molecular weight 46.12kDa
Protein delivered with Tag? C-terminal Fc Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Ser192
Protein Accession P70380
Spec:Entrez GeneID 16173
Spec:NCBI Gene Aliases Ig; Il-; Igif; Il-18
NCBI Reference P70380
Aliases /Synonyms IL-18,Interferon gamma-inducing factor,IFN-gamma-inducing factor,Interleukin-1 gamma,IL-1 gamma,Igif
Reference PX-P4661
Note For research use only
Molecular Constructor
Met1–Ser192 Fc

Mouse Interleukin-18(Il18)

There are no reviews yet.

Be the first to review “Mouse Interleukin-18(Il18)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products