Skip to main content
Contact +1 (919) 234-1277

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Interleukin-12 (Il12a &Il12b heterodimer) (Met1-Ala215)&(Met1-Ser335)

Host species:
Mammalian cells
Origin species:
House Mouse
Uniprot ID:
P43431&P43432
Molecular weight:
Il12a(25kDa) & Il12b（45-60kDa)

$250.00

50ug + 250 loyalty points
Met1–Ala215 Il12a& Il12b(Met1-Ser335 His Twin-Strep
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Interleukin-12 (Il12a &Il12b heterodimer) (Met1-Ala215)&(Met1-Ser335)

Interleukin-12 (Il12a &Il12b heterodimer) (Met1-Ala215)&(Met1-Ser335)

Product name Interleukin-12 (Il12a &Il12b heterodimer) (Met1-Ala215)&(Met1-Ser335)
Uniprot ID P43431&P43432
Uniprot link https://www.uniprot.org/uniprot/P43432 & https://www.uniprot.org/uniprot/P43431
Origin species House Mouse
Expression system Eukaryotic expression
Sequence MCQSRYLLFLATLALLNHLSLARVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSA & MCPQKLTISWFAIVLLVSPLMAMWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS
Molecular weight Il12a(25kDa) & Il12b（45-60kDa)
Protein delivered with Tag? C-terminal His Tag & C-terminal Twin-Strep tag
Purity estimated >95% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Il12a(Met1-Ala215)& Il12b(Met1-Ser335)
Protein Accession P43431&P43432
Spec:Entrez GeneID 16160 & 16159
Spec:NCBI Gene Aliases p40; Il-1; Il-12; Il-12b; Il12p40; Il-12p40;p3; p35; IL-12; Ll12a; Il-12a; IL-12p35
NCBI Reference P43431&P43432
Aliases /Synonyms IL-12 subunit p35 & IL-12 subunit p40
Reference PX-P4570
Note For research use only
Molecular Constructor
Met1–Ala215 Il12a& Il12b(Met1-Ser335 His Twin-Strep
Product name Interleukin-12 (Il12a &Il12b heterodimer) (Met1-Ala215)&(Met1-Ser335)
Uniprot ID P43431&P43432
Uniprot link https://www.uniprot.org/uniprot/P43432 & https://www.uniprot.org/uniprot/P43431
Origin species House Mouse
Expression system Eukaryotic expression
Sequence MCQSRYLLFLATLALLNHLSLARVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSA & MCPQKLTISWFAIVLLVSPLMAMWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS
Molecular weight Il12a(25kDa) & Il12b（45-60kDa)
Protein delivered with Tag? C-terminal His Tag & C-terminal Twin-Strep tag
Purity estimated >95% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Il12a(Met1-Ala215)& Il12b(Met1-Ser335)
Protein Accession P43431&P43432
Spec:Entrez GeneID 16160 & 16159
Spec:NCBI Gene Aliases p40; Il-1; Il-12; Il-12b; Il12p40; Il-12p40;p3; p35; IL-12; Ll12a; Il-12a; IL-12p35
NCBI Reference P43431&P43432
Aliases /Synonyms IL-12 subunit p35 & IL-12 subunit p40
Reference PX-P4570
Note For research use only
Molecular Constructor
Met1–Ala215 Il12a& Il12b(Met1-Ser335 His Twin-Strep

There are no reviews yet.

Be the first to review “Interleukin-12 (Il12a &Il12b heterodimer) (Met1-Ala215)&(Met1-Ser335)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products