Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Aspergillus fumigatus Asp f 1/mitF Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)
Uniprot ID:
P67875
Molecular weight:
19.15 kDa

Original price was: $274.00.Current price is: $230.00.

50ug 16% OFF + 230 loyalty points
Ala28–His176
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Aspergillus fumigatus Asp f 1/mitF Protein, N-His

Product name ARO-P11499-100
Uniprot ID P67875
Origin species Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)
Expression system Prokaryotic expression
Raw Antigen Sequence ATWTCINQQLNPKTNKWEDKRLLYSQAKAESNSHHAPLSDGKTGSSYPHWFTNGYDGNGKLIKGRTPIKFGKADCDRPPKHSQNGMGKDDHYLLEFPTFPDGHDYKFDSKKPKEDPGPARVIYTYPNKVFCGIVAHQRGNQGDLRLCSH
Molecular weight 19.15 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala28-His176
Aliases /Synonyms Ribonuclease mitogillin, 3.1.27.-, Allergen Asp f I, Allergen I/a, IgE-binding ribotoxin, Major allergen Asp f 1, Asp f 1, mitF, aspF1, AFUA_5G02330
Reference ARO-P11499
Note For research use only.
Molecular Constructor
Ala28–His176
Product name ARO-P11499-1MG
Uniprot ID P67875
Origin species Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)
Expression system Prokaryotic expression
Raw Antigen Sequence ATWTCINQQLNPKTNKWEDKRLLYSQAKAESNSHHAPLSDGKTGSSYPHWFTNGYDGNGKLIKGRTPIKFGKADCDRPPKHSQNGMGKDDHYLLEFPTFPDGHDYKFDSKKPKEDPGPARVIYTYPNKVFCGIVAHQRGNQGDLRLCSH
Molecular weight 19.15 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala28-His176
Aliases /Synonyms Ribonuclease mitogillin, 3.1.27.-, Allergen Asp f I, Allergen I/a, IgE-binding ribotoxin, Major allergen Asp f 1, Asp f 1, mitF, aspF1, AFUA_5G02330
Reference ARO-P11499
Note For research use only.
Molecular Constructor
Ala28–His176
Product name ARO-P11499-50
Uniprot ID P67875
Origin species Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)
Expression system Prokaryotic expression
Raw Antigen Sequence ATWTCINQQLNPKTNKWEDKRLLYSQAKAESNSHHAPLSDGKTGSSYPHWFTNGYDGNGKLIKGRTPIKFGKADCDRPPKHSQNGMGKDDHYLLEFPTFPDGHDYKFDSKKPKEDPGPARVIYTYPNKVFCGIVAHQRGNQGDLRLCSH
Molecular weight 19.15 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala28-His176
Aliases /Synonyms Ribonuclease mitogillin, 3.1.27.-, Allergen Asp f I, Allergen I/a, IgE-binding ribotoxin, Major allergen Asp f 1, Asp f 1, mitF, aspF1, AFUA_5G02330
Reference ARO-P11499
Note For research use only.
Molecular Constructor
Ala28–His176

Introduction

The Recombinant Aspergillus fumigatus Asp f 1/mitF Protein is a highly studied and well-characterized protein that plays a crucial role in the pathogenesis of Aspergillus fumigatus, a common fungal pathogen. This protein has been extensively studied for its structure, activity, and potential applications in various fields. In this article, we will provide a detailed description of the Recombinant Asp f 1/mitF Protein, highlighting its structure, activity, and potential applications as an antigen.

Structure of Recombinant Asp f 1/mitF Protein

The Recombinant Asp f 1/mitF Protein is a 16 kDa protein that is encoded by the mitF gene in Aspergillus fumigatus. It is a glycoprotein with a molecular weight of 18 kDa due to the presence of N-linked glycans. The protein consists of 156 amino acids and has a predicted isoelectric point of 4.6.

The crystal structure of the Recombinant Asp f 1/mitF Protein has been determined, revealing a beta-barrel structure with a conserved beta-sheet core and a highly flexible loop region. The protein also contains two disulfide bonds, which are essential for its stability and activity.

Activity of Recombinant Asp f 1/mitF Protein

The Recombinant Asp f 1/mitF Protein is a potent allergen and is known to elicit strong immune responses in individuals with Aspergillus fumigatus sensitization. It is the major allergen responsible for allergic bronchopulmonary aspergillosis (ABPA), a severe allergic lung disease. The protein is also involved in the pathogenesis of invasive aspergillosis, a life-threatening infection that affects immunocompromised individuals.

Studies have shown that the Recombinant Asp f 1/mitF Protein has protease activity, which is believed to contribute to its allergenicity and pathogenicity. It can cleave host proteins, such as immunoglobulins and extracellular matrix proteins, leading to tissue damage and inflammation.

Applications of Recombinant Asp f 1/mitF Protein

Due to its strong immunogenic and protease activity, the Recombinant Asp f 1/mitF Protein has potential applications in various fields, including diagnosis, treatment, and vaccine development.

Diagnosis

The Recombinant Asp f 1/mitF Protein can be used as a diagnostic tool for Aspergillus fumigatus sensitization and ABPA. It can be used in skin prick tests and specific IgE assays to identify individuals with Aspergillus fumigatus allergy. The protein can also be used in ELISA-based tests for the diagnosis of ABPA, as it is the major allergen responsible for this condition.

Treatment

The protease activity of the Recombinant Asp f 1/mitF Protein makes it a potential target for antifungal therapies. Inhibitors of this protein could potentially prevent tissue damage and reduce the severity of allergic and invasive aspergillosis. Additionally, the protein can also be used as a target for immunotherapy, where it can be used to induce tolerance in individuals with Aspergillus fumigatus allergy.

Vaccine Development

The Recombinant Asp f 1/mitF Protein has been studied as a potential candidate for a vaccine against Aspergillus fumigatus. It has been shown to induce a strong immune response and could potentially protect against allergic and invasive aspergillosis. However, further research is needed to develop a safe and effective vaccine using this protein.

Conclusion

The Recombinant Aspergillus fumig

Recombinant Aspergillus fumigatus Asp f 1/mitF Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Aspergillus fumigatus Asp f 1/mitF Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products