Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human AMIGO1, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q86WK6
Molecular weight:
41.58 kDa

Original price was: $262.00.Current price is: $230.00.

50ug 12% OFF + 230 loyalty points
Gly28–Thr372
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human AMIGO1, N-His

Product name ARO-P12917-100
Uniprot ID Q86WK6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GRAVVSCPAACLCASNILSCSKQQLPNVPHSLPSYTALLDLSHNNLSRLRAEWTPTRLTQLHSLLLSHNHLNFISSEAFSPVPNLRYLDLSSNQLRTLDEFLFSDLQVLEVLLLYNNHIMAVDRCAFDDMAQLQKLYLSQNQISRFPLELVKEGAKLPKLTLLDLSSNKLKNLPLPDLQKLPAWIKNGLYLHNNPLNCDCELYQLFSHWQYRQLSSVMDFQEDLYCMNSKKLHNVFNLSFLNCGEYKERAWEAHLGDTLIIKCDTKQQGMTKVWVTPSNERVLDEVTNGTVSVSKDGSLLFQQVQVEDGGVYTCYAMGETFNETLSVELKVHNFTLHGHHDTLNT
Molecular weight 41.58 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly28-Thr372
Aliases /Synonyms AMIGO, AMIGO1, Amphoterin-induced protein 1, AMIGO-1, KIAA1163, Alivin-2, ALI2
Reference ARO-P12917
Note For research use only.
Molecular Constructor
Gly28–Thr372
Product name ARO-P12917-1MG
Uniprot ID Q86WK6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GRAVVSCPAACLCASNILSCSKQQLPNVPHSLPSYTALLDLSHNNLSRLRAEWTPTRLTQLHSLLLSHNHLNFISSEAFSPVPNLRYLDLSSNQLRTLDEFLFSDLQVLEVLLLYNNHIMAVDRCAFDDMAQLQKLYLSQNQISRFPLELVKEGAKLPKLTLLDLSSNKLKNLPLPDLQKLPAWIKNGLYLHNNPLNCDCELYQLFSHWQYRQLSSVMDFQEDLYCMNSKKLHNVFNLSFLNCGEYKERAWEAHLGDTLIIKCDTKQQGMTKVWVTPSNERVLDEVTNGTVSVSKDGSLLFQQVQVEDGGVYTCYAMGETFNETLSVELKVHNFTLHGHHDTLNT
Molecular weight 41.58 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly28-Thr372
Aliases /Synonyms AMIGO, AMIGO1, Amphoterin-induced protein 1, AMIGO-1, KIAA1163, Alivin-2, ALI2
Reference ARO-P12917
Note For research use only.
Molecular Constructor
Gly28–Thr372
Product name ARO-P12917-50
Uniprot ID Q86WK6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GRAVVSCPAACLCASNILSCSKQQLPNVPHSLPSYTALLDLSHNNLSRLRAEWTPTRLTQLHSLLLSHNHLNFISSEAFSPVPNLRYLDLSSNQLRTLDEFLFSDLQVLEVLLLYNNHIMAVDRCAFDDMAQLQKLYLSQNQISRFPLELVKEGAKLPKLTLLDLSSNKLKNLPLPDLQKLPAWIKNGLYLHNNPLNCDCELYQLFSHWQYRQLSSVMDFQEDLYCMNSKKLHNVFNLSFLNCGEYKERAWEAHLGDTLIIKCDTKQQGMTKVWVTPSNERVLDEVTNGTVSVSKDGSLLFQQVQVEDGGVYTCYAMGETFNETLSVELKVHNFTLHGHHDTLNT
Molecular weight 41.58 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly28-Thr372
Aliases /Synonyms AMIGO, AMIGO1, Amphoterin-induced protein 1, AMIGO-1, KIAA1163, Alivin-2, ALI2
Reference ARO-P12917
Note For research use only.
Molecular Constructor
Gly28–Thr372

Introduction to Recombinant Human AMIGO1

Recombinant Human AMIGO1, also known as Alivin 1, is a protein that plays a critical role in the development and function of the nervous system. It is a member of the AMIGO family of proteins, which are characterized by their ability to interact with other proteins and form complex signaling networks. Recombinant Human AMIGO1 has been extensively studied and has shown potential as a therapeutic agent for various neurological disorders. In this article, we will discuss the structure, activity, and potential applications of this important protein.

Structure of Recombinant Human AMIGO1

Recombinant Human AMIGO1 is a 100 kDa transmembrane protein that is composed of 838 amino acids. It is primarily expressed in the brain and spinal cord, with lower levels found in other tissues such as the heart and kidney. The protein is made up of several domains, including an extracellular domain, a transmembrane domain, and an intracellular domain.

The extracellular domain of Recombinant Human AMIGO1 contains several immunoglobulin-like domains, which are important for protein-protein interactions. These domains allow Recombinant Human AMIGO1 to interact with other proteins, such as the neural cell adhesion molecule (NCAM), and form complex signaling networks involved in neuronal development and function.

The transmembrane domain of Recombinant Human AMIGO1 anchors the protein to the cell membrane, while the intracellular domain is responsible for signaling and regulating cellular processes. This domain contains several phosphorylation sites, which are important for the activation and regulation of Recombinant Human AMIGO1.

Activity of Recombinant Human AMIGO1

Recombinant Human AMIGO1 plays a crucial role in the development and function of the nervous system. It is primarily involved in cell adhesion and signaling, which are essential processes for proper neuronal development and function.

One of the main functions of Recombinant Human AMIGO1 is to regulate the growth and branching of axons, the long projections of nerve cells that transmit electrical signals. Recombinant Human AMIGO1 interacts with other proteins, such as NCAM, to promote axon growth and branching. This activity is crucial for the formation of neural networks and proper communication between neurons.

In addition to its role in axon growth, Recombinant Human AMIGO1 also plays a role in synapse formation and plasticity. Synapses are the connections between neurons where communication and signaling occur. Recombinant Human AMIGO1 helps to regulate the formation and stability of synapses, which is important for learning and memory.

Application of Recombinant Human AMIGO1

Given its important role in neuronal development and function, Recombinant Human AMIGO1 has potential applications in the treatment of neurological disorders. For example, studies have shown that Recombinant Human AMIGO1 can promote axon growth and regeneration in models of spinal cord injury and peripheral nerve injury. This makes it a promising candidate for the treatment of nerve damage and paralysis.

Recombinant Human AMIGO1 has also shown potential as a therapeutic agent for neurodegenerative diseases, such as Alzheimer’s and Parkinson’s disease. These diseases are characterized by the loss of synapses and neuronal connections, and Recombinant Human AMIGO1 may help to promote synapse formation and plasticity, potentially slowing down the progression of these diseases.

In addition, Recombinant Human AMIGO1 has been studied as a potential therapy for psychiatric disorders, such as schizophrenia and depression. These disorders are associated with abnormalities in neuronal signaling and communication, and Recombinant Human AMIGO1 may help to regulate these processes.

Conclusion

In summary, Recombinant Human AMIGO1 is a protein with a complex structure and important activity in the nervous system. It plays a critical role in neuronal development, axon growth, and synapse formation, and has potential applications in the treatment of various neurological disorders. Further research and development of Recombinant Human AMIGO1 may lead to

Recombinant Human AMIGO1, N-His

There are no reviews yet.

Be the first to review “Recombinant Human AMIGO1, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products