Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ARF1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P84077
Molecular weight:
22.86 kDa

Original price was: $322.00.Current price is: $274.00.

50ug 15% OFF + 274 loyalty points
Met1–Lys181
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ARF1 Protein, N-His

Product name ARO-P12400-100
Uniprot ID P84077
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK
Molecular weight 22.86 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys181
Aliases /Synonyms ADP-ribosylation factor 1, ARF1
Reference ARO-P12400
Note For research use only.
Molecular Constructor
Met1–Lys181
Product name ARO-P12400-1MG
Uniprot ID P84077
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK
Molecular weight 22.86 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys181
Aliases /Synonyms ADP-ribosylation factor 1, ARF1
Reference ARO-P12400
Note For research use only.
Molecular Constructor
Met1–Lys181
Product name ARO-P12400-50
Uniprot ID P84077
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK
Molecular weight 22.86 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys181
Aliases /Synonyms ADP-ribosylation factor 1, ARF1
Reference ARO-P12400
Note For research use only.
Molecular Constructor
Met1–Lys181

Introduction

Recombinant Human ARF1 Protein, also known as ADP-ribosylation factor 1, is a small GTPase protein that plays a crucial role in intracellular vesicular trafficking and membrane dynamics. This protein is encoded by the ARF1 gene and is expressed in various tissues and cell types, making it a widely studied and important protein in the field of cell biology and biochemistry.

Structure of Recombinant Human ARF1 Protein

The recombinant human ARF1 protein is a 181 amino acid long protein with a molecular weight of approximately 20 kDa. It belongs to the ARF family of small GTPases, which are involved in regulating various cellular processes such as vesicle formation, membrane trafficking, and cytoskeletal organization.

The protein structure of ARF1 consists of a central beta-sheet surrounded by several alpha helices, forming a globular shape. It also contains a nucleotide-binding domain, which is essential for its GTPase activity, and a lipid-binding domain, which allows it to interact with membranes.

Activity of Recombinant Human ARF1 Protein

Recombinant Human ARF1 Protein is primarily known for its role in regulating vesicular trafficking within cells. It is activated by GTP binding, which causes a conformational change in the protein and exposes its lipid-binding domain. This allows ARF1 to interact with membranes and recruit other proteins involved in vesicle formation and transport.

ARF1 also plays a crucial role in maintaining the integrity of the Golgi apparatus, a cellular organelle involved in protein modification and sorting. It does so by regulating the formation and fusion of transport vesicles that shuttle cargo molecules between the Golgi and other cellular compartments.

In addition to its role in vesicular trafficking, ARF1 has also been shown to regulate actin cytoskeleton dynamics, which is essential for cell movement and shape changes. It achieves this by interacting with various actin-binding proteins and modulating their activity.

Applications of Recombinant Human ARF1 Protein

Recombinant Human ARF1 Protein has a wide range of applications in both research and biotechnology. Its ability to regulate vesicular trafficking and membrane dynamics makes it a crucial tool in studying various cellular processes. Some of the specific applications of ARF1 protein include:

1. Study of intracellular protein trafficking

The recombinant human ARF1 protein is commonly used to study the mechanisms of intracellular protein trafficking. By manipulating its activity, researchers can investigate the role of ARF1 in vesicle formation, transport, and fusion, and how it affects the overall cellular trafficking process.

2. Drug target identification

As ARF1 is involved in various cellular processes, it has been identified as a potential drug target for diseases such as cancer and neurodegenerative disorders. Recombinant Human ARF1 protein can be used to screen and identify compounds that modulate its activity, which can then be further developed into potential therapeutic agents.

3. Production of recombinant proteins

The lipid-binding domain of ARF1 allows it to interact with membranes and facilitate the formation of transport vesicles. This property has been utilized in the biotechnology industry to produce recombinant proteins. By fusing the lipid-binding domain of ARF1 to a desired protein, researchers can target it to specific cellular compartments and enhance its production and secretion.

4. Development of diagnostic assays

Recombinant Human ARF1 protein has been used to develop diagnostic assays for various diseases. For example, it has been used as an antigen in ELISA tests to detect the presence of autoantibodies in patients with autoimmune diseases such as rheumatoid arthritis.

Conclusion

In summary, Recombinant Human ARF1 Protein is a crucial protein involved in regulating intracellular vesicular trafficking and membrane dynamics. Its structure, activity, and various applications make it a valuable tool in

Recombinant Human ARF1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ARF1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products