Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CREB3L2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q70SY1
Molecular weight:
17.58 kDa

Original price was: $387.00.Current price is: $327.00.

100ug 16% OFF + 327 loyalty points
Ala245–Leu380
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CREB3L2 Protein, N-His

Product name ARO-P11261-100
Uniprot ID Q70SY1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ALSSSPLLTAPHKLQGSGPLVLTEEEKRTLIAEGYPIPTKLPLSKSEEKALKKIRRKIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNRTLLQQLQKLQTLVMGKVSRTCKLAGTQTGTCL
Molecular weight 17.58 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala245-Leu380
Aliases /Synonyms CREB3L2, Cyclic AMP-responsive element-binding protein 3-like protein 2, cAMP-responsive element-binding protein 3-like protein 2, BBF2H7, BBF2 human homolog on chromosome 7
Reference ARO-P11261
Note For research use only.
Molecular Constructor
Ala245–Leu380
Product name ARO-P11261-1MG
Uniprot ID Q70SY1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ALSSSPLLTAPHKLQGSGPLVLTEEEKRTLIAEGYPIPTKLPLSKSEEKALKKIRRKIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNRTLLQQLQKLQTLVMGKVSRTCKLAGTQTGTCL
Molecular weight 17.58 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala245-Leu380
Aliases /Synonyms CREB3L2, Cyclic AMP-responsive element-binding protein 3-like protein 2, cAMP-responsive element-binding protein 3-like protein 2, BBF2H7, BBF2 human homolog on chromosome 7
Reference ARO-P11261
Note For research use only.
Molecular Constructor
Ala245–Leu380
Product name ARO-P11261-50
Uniprot ID Q70SY1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ALSSSPLLTAPHKLQGSGPLVLTEEEKRTLIAEGYPIPTKLPLSKSEEKALKKIRRKIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNRTLLQQLQKLQTLVMGKVSRTCKLAGTQTGTCL
Molecular weight 17.58 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala245-Leu380
Aliases /Synonyms CREB3L2, Cyclic AMP-responsive element-binding protein 3-like protein 2, cAMP-responsive element-binding protein 3-like protein 2, BBF2H7, BBF2 human homolog on chromosome 7
Reference ARO-P11261
Note For research use only.
Molecular Constructor
Ala245–Leu380

Introduction to Recombinant Human CREB3L2 Protein

Recombinant Human CREB3L2 Protein, also known as cAMP-responsive element-binding protein 3-like protein 2, is a protein encoded by the CREB3L2 gene. This protein belongs to the CREB/ATF family of transcription factors and plays a crucial role in regulating gene expression. Recombinant CREB3L2 Protein is produced using recombinant DNA technology, making it a valuable tool for studying its structure, activity, and various applications.

Structure of Recombinant Human CREB3L2 Protein

The recombinant CREB3L2 Protein is a 55 kDa protein consisting of 486 amino acids. It contains a basic leucine zipper (bZIP) domain, which is involved in DNA binding and dimerization, and a transmembrane domain. The bZIP domain is crucial for the transcriptional activity of CREB3L2, and mutations in this domain have been linked to various diseases.

The structure of recombinant CREB3L2 Protein has been extensively studied using techniques like X-ray crystallography and nuclear magnetic resonance (NMR) spectroscopy. These studies have provided insights into the three-dimensional structure of the protein, which is essential for understanding its function and interactions with other molecules.

Activity of Recombinant Human CREB3L2 Protein

Recombinant CREB3L2 Protein is a transcription factor that regulates gene expression by binding to specific DNA sequences called cAMP-responsive elements (CREs). Upon activation, CREB3L2 translocates from the endoplasmic reticulum (ER) to the nucleus, where it binds to CREs and activates the transcription of target genes.

The activity of recombinant CREB3L2 Protein is regulated by various mechanisms, including post-translational modifications like phosphorylation and proteolytic cleavage. Phosphorylation of CREB3L2 by kinases like PKA and MAPK enhances its transcriptional activity, while cleavage by proteases like S1P and S2P releases its active form from the ER membrane.

Applications of Recombinant Human CREB3L2 Protein

Recombinant CREB3L2 Protein has a wide range of applications in both basic research and clinical settings. Some of the key applications include:

1. Studying the role of CREB3L2 in diseases

Mutations in the CREB3L2 gene have been linked to various diseases, including osteogenesis imperfecta, Charcot-Marie-Tooth disease, and Paget’s disease of bone. Recombinant CREB3L2 Protein can be used to study the structure and function of the protein, as well as its role in these diseases. This can help in understanding the underlying mechanisms and developing potential treatments.

2. Screening for potential drugs

As a transcription factor, CREB3L2 plays a crucial role in regulating gene expression. Recombinant CREB3L2 Protein can be used in high-throughput screening assays to identify small molecule compounds that can modulate its activity. These compounds can then be further developed as potential drugs for diseases where CREB3L2 is involved.

3. Development of diagnostic tools

The expression of CREB3L2 has been found to be dysregulated in various cancers, making it a potential biomarker for cancer diagnosis and prognosis. Recombinant CREB3L2 Protein can be used to develop diagnostic tools like ELISA or immunohistochemistry kits for detecting CREB3L2 levels in patient samples.

4. Protein-protein interaction studies

Recombinant CREB3L2 Protein can be used in various protein-protein interaction

Recombinant Human CREB3L2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CREB3L2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products