Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human FUS Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P35637
Molecular weight:
21.74 kDa

Original price was: $292.00.Current price is: $230.00.

50ug 21% OFF + 230 loyalty points
Ser282–Ser367
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human FUS Protein, N-His-SUMO

Product name ARO-P10780-100
Uniprot ID P35637
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVS
Molecular weight 21.74 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser282-Ser367
Aliases /Synonyms Oncogene TLS, Oncogene FUS, TLS, POMp75, RNA-binding protein FUS, 75 kDa DNA-pairing protein, Translocated in liposarcoma protein, FUS
Reference ARO-P10780
Note For research use only.
Molecular Constructor
Ser282–Ser367
Product name ARO-P10780-1MG
Uniprot ID P35637
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVS
Molecular weight 21.74 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser282-Ser367
Aliases /Synonyms Oncogene TLS, Oncogene FUS, TLS, POMp75, RNA-binding protein FUS, 75 kDa DNA-pairing protein, Translocated in liposarcoma protein, FUS
Reference ARO-P10780
Note For research use only.
Molecular Constructor
Ser282–Ser367
Product name ARO-P10780-50
Uniprot ID P35637
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVS
Molecular weight 21.74 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser282-Ser367
Aliases /Synonyms Oncogene TLS, Oncogene FUS, TLS, POMp75, RNA-binding protein FUS, 75 kDa DNA-pairing protein, Translocated in liposarcoma protein, FUS
Reference ARO-P10780
Note For research use only.
Molecular Constructor
Ser282–Ser367

Introduction

Recombinant Human FUS Protein, also known as Fused in Sarcoma protein, is a highly conserved nuclear protein that plays a crucial role in various cellular processes such as RNA processing, DNA repair, and transcriptional regulation. It is encoded by the FUS gene located on chromosome 16 in humans. This protein has been extensively studied and has been found to be involved in several diseases, making it an important target for research and potential therapeutic applications.

Structure of Recombinant Human FUS Protein

The FUS protein is composed of 526 amino acids with a molecular weight of approximately 60 kDa. It contains several functional domains, including an N-terminal domain rich in glutamine, glycine, and serine residues, a nuclear localization signal, and a C-terminal RNA recognition motif (RRM). The RRM domain is responsible for binding to RNA and is essential for the proper functioning of FUS protein. Additionally, FUS protein has been found to form liquid droplets in the nucleus, which is thought to be important for its role in RNA processing.

Activity of Recombinant Human FUS Protein

The primary function of FUS protein is to regulate RNA metabolism by binding to RNA and influencing its processing, transport, and translation. It has been shown to interact with various RNA-binding proteins, such as hnRNP A1, hnRNP K, and TDP-43, to form ribonucleoprotein complexes that are involved in RNA splicing, transport, and stability. FUS protein has also been found to play a role in DNA repair by interacting with DNA damage response proteins, such as ATM and DNA-PK. Moreover, FUS protein has been shown to regulate transcription by binding to promoter regions of specific genes and influencing their expression.

Application of Recombinant Human FUS Protein

Recombinant Human FUS Protein has been widely used in research to study its role in various cellular processes and its involvement in diseases. It has been shown to play a crucial role in neurodegenerative diseases, such as amyotrophic lateral sclerosis (ALS) and frontotemporal lobar degeneration (FTLD). Mutations in the FUS gene have been linked to these diseases, and studies have shown that these mutations can affect the function and localization of FUS protein, leading to disease pathology. Additionally, FUS protein has been found to be involved in other diseases, such as cancer, where it has been shown to regulate cell proliferation and survival.

Recombinant Human FUS Protein has also been used in drug discovery and development. It has been identified as a potential therapeutic target for ALS and FTLD, and studies have shown that targeting FUS protein can alleviate disease symptoms in animal models. Furthermore, FUS protein has been used in in vitro assays to screen for potential drugs that can modulate its activity and potentially treat diseases associated with FUS dysfunction.

Conclusion

In conclusion, Recombinant Human FUS Protein is a crucial nuclear protein involved in various cellular processes and has been found to be associated with several diseases. Its structure, activity, and application have been extensively studied, making it an important target for further research and potential therapeutic interventions. With ongoing studies and advancements in technology, the role of FUS protein in diseases and its potential as a therapeutic target will continue to be explored, providing a deeper understanding of its function and potential for treatment.

Recombinant Human FUS Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human FUS Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products