Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human GPR37 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O15354
Molecular weight:
32.97 kDa

Original price was: $292.00.Current price is: $230.00.

50ug 21% OFF + 230 loyalty points
Arg401–Leu443
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human GPR37 Protein, N-GST & C-His

Product name ARO-P11357-100
Uniprot ID O15354
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RQLSKEDLGFSGRAPAERCIIKISPDLPDTIYVLALTYDSARL
Molecular weight 32.97 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg401-Leu443
Aliases /Synonyms Endothelin B receptor-like protein 1, G-protein coupled receptor 37, Prosaposin receptor GPR37, Parkin-associated endothelin receptor-like receptor, GPR37, PAELR, ETBR-LP-1
Reference ARO-P11357
Note For research use only.
Molecular Constructor
Arg401–Leu443
Product name ARO-P11357-1MG
Uniprot ID O15354
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RQLSKEDLGFSGRAPAERCIIKISPDLPDTIYVLALTYDSARL
Molecular weight 32.97 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg401-Leu443
Aliases /Synonyms Endothelin B receptor-like protein 1, G-protein coupled receptor 37, Prosaposin receptor GPR37, Parkin-associated endothelin receptor-like receptor, GPR37, PAELR, ETBR-LP-1
Reference ARO-P11357
Note For research use only.
Molecular Constructor
Arg401–Leu443
Product name ARO-P11357-50
Uniprot ID O15354
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RQLSKEDLGFSGRAPAERCIIKISPDLPDTIYVLALTYDSARL
Molecular weight 32.97 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg401-Leu443
Aliases /Synonyms Endothelin B receptor-like protein 1, G-protein coupled receptor 37, Prosaposin receptor GPR37, Parkin-associated endothelin receptor-like receptor, GPR37, PAELR, ETBR-LP-1
Reference ARO-P11357
Note For research use only.
Molecular Constructor
Arg401–Leu443

Introduction

Recombinant Human GPR37 Protein, also known as Glutamate Receptor-Like Protein 1 (GRL1), is a member of the G protein-coupled receptor (GPCR) superfamily. This protein plays a crucial role in regulating neuronal development and function, making it an important target for research in neurological disorders. In this article, we will discuss the structure, activity, and applications of Recombinant Human GPR37 Protein.

Structure of Recombinant Human GPR37 Protein

The human GPR37 gene is located on chromosome 7 and encodes a protein of 560 amino acids. The protein is composed of seven transmembrane domains, an extracellular N-terminus, and an intracellular C-terminus. The extracellular N-terminus contains several glycosylation sites, which are important for protein stability and function. The intracellular C-terminus contains a PDZ domain-binding motif, which allows GPR37 to interact with other proteins and regulate downstream signaling pathways.

Activity of Recombinant Human GPR37 Protein

GPR37 is predominantly expressed in the central nervous system, specifically in the striatum, cortex, and hippocampus. It is also expressed in the pancreas, kidney, and heart, albeit at lower levels. GPR37 is activated by the endogenous ligand prosaposin, a neurotrophic factor that is involved in neuronal survival and differentiation. Upon activation, GPR37 signals through G protein-mediated pathways, leading to the activation of downstream signaling cascades. These include the mitogen-activated protein kinase (MAPK) pathway, which is involved in cell proliferation and survival, and the phosphoinositide 3-kinase (PI3K) pathway, which regulates cell growth and metabolism.

Applications of Recombinant Human GPR37 Protein

The unique structure and activity of GPR37 make it a promising target for therapeutic interventions in various neurological disorders. Studies have shown that mutations in the GPR37 gene are associated with Parkinson’s disease, Huntington’s disease, and Alzheimer’s disease. Therefore, understanding the role of GPR37 in these diseases and developing therapies to modulate its activity could potentially have a significant impact on patient outcomes.

One potential application of Recombinant Human GPR37 Protein is in the treatment of Parkinson’s disease. Studies have shown that GPR37 is involved in the clearance of alpha-synuclein, a protein that forms toxic aggregates in Parkinson’s disease. Therefore, enhancing GPR37 activity could potentially reduce the accumulation of alpha-synuclein and slow the progression of the disease.

In addition, GPR37 has been implicated in regulating dopamine signaling, which is disrupted in Parkinson’s disease. Recombinant Human GPR37 Protein could be used to study the role of GPR37 in dopamine signaling and potentially develop novel therapies to modulate this pathway.

Furthermore, GPR37 has been shown to have neuroprotective effects in animal models of stroke and traumatic brain injury. Recombinant Human GPR37 Protein could be used to further investigate these effects and potentially develop therapies to promote neuronal survival and recovery after brain injury.

Conclusion

In summary, Recombinant Human GPR37 Protein is a unique GPCR with important roles in neuronal development and function. Its structure, activity, and potential applications in neurological disorders make it an attractive target for further research and therapeutic development. With continued studies and advancements in recombinant protein technology, we can gain a better understanding of GPR37 and potentially develop novel treatments for neurological disorders.

Recombinant Human GPR37 Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human GPR37 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products