Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human UBE2L3, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P68036
Molecular weight:
19.90 kDa

Original price was: $264.00.Current price is: $230.00.

50ug 13% OFF + 230 loyalty points
His Ser4–Asp154
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human UBE2L3, N-His

Product name ARO-P13563-100
Uniprot ID P68036
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD
Molecular weight 19.90 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser4-Asp154
Aliases /Synonyms UBE2L3, Ubiquitin-conjugating enzyme E2-F1, UBCH7, Ubiquitin-conjugating enzyme E2 L3, UBCE7, L-UBC, E2 ubiquitin-conjugating enzyme L3, UbcH7, Ubiquitin-protein ligase L3, Ubiquitin carrier protein L3
Reference ARO-P13563
Note For research use only.
Molecular Constructor
His Ser4–Asp154
Product name ARO-P13563-1MG
Uniprot ID P68036
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD
Molecular weight 19.90 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser4-Asp154
Aliases /Synonyms UBE2L3, Ubiquitin-conjugating enzyme E2-F1, UBCH7, Ubiquitin-conjugating enzyme E2 L3, UBCE7, L-UBC, E2 ubiquitin-conjugating enzyme L3, UbcH7, Ubiquitin-protein ligase L3, Ubiquitin carrier protein L3
Reference ARO-P13563
Note For research use only.
Molecular Constructor
His Ser4–Asp154
Product name ARO-P13563-50
Uniprot ID P68036
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD
Molecular weight 19.90 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser4-Asp154
Aliases /Synonyms UBE2L3, Ubiquitin-conjugating enzyme E2-F1, UBCH7, Ubiquitin-conjugating enzyme E2 L3, UBCE7, L-UBC, E2 ubiquitin-conjugating enzyme L3, UbcH7, Ubiquitin-protein ligase L3, Ubiquitin carrier protein L3
Reference ARO-P13563
Note For research use only.
Molecular Constructor
His Ser4–Asp154

Introduction

Recombinant Human UBE2L3, also known as Ubiquitin-conjugating enzyme E2 L3, is a recombinant protein that plays a crucial role in the ubiquitin-proteasome pathway. This pathway is responsible for the degradation of damaged or unwanted proteins in the cell, making UBE2L3 an important player in cellular homeostasis and regulation.

Structure of Recombinant Human UBE2L3

UBE2L3 is a member of the E2 family of ubiquitin-conjugating enzymes, which are responsible for transferring ubiquitin molecules to target proteins. It is composed of 148 amino acids and has a molecular weight of approximately 17 kDa. The protein has a conserved catalytic core domain, which is essential for its enzymatic activity. UBE2L3 also contains a C-terminal extension that is involved in protein-protein interactions, allowing it to interact with other proteins in the ubiquitin-proteasome pathway.

Enzymatic Activity of Recombinant Human UBE2L3

The main function of UBE2L3 is to catalyze the transfer of ubiquitin from an E1 ubiquitin-activating enzyme to a target protein. This process, known as ubiquitination, marks the target protein for degradation by the proteasome. UBE2L3 specifically interacts with an E3 ubiquitin ligase, which helps to recognize and bind to the target protein, allowing for efficient ubiquitination. UBE2L3 has been shown to have a high affinity for its target proteins, making it a key player in the ubiquitin-proteasome pathway.

Applications of Recombinant Human UBE2L3

Due to its crucial role in the ubiquitin-proteasome pathway, UBE2L3 has a wide range of applications in both research and clinical settings.

Research

Recombinant Human UBE2L3 is commonly used in research studies to investigate the role of the ubiquitin-proteasome pathway in various cellular processes. It can be used to study the degradation of specific target proteins and the effects of their ubiquitination on cellular function. UBE2L3 can also be used to explore the mechanisms of protein-protein interactions within the ubiquitin-proteasome pathway.

Clinical Applications

Defects in the ubiquitin-proteasome pathway have been linked to various diseases, including cancer and neurodegenerative disorders. Recombinant Human UBE2L3 can be used in clinical research to better understand the role of this pathway in disease development and to potentially develop new treatments. Additionally, UBE2L3 has been identified as a potential therapeutic target for certain types of cancer, making it a promising candidate for drug development.

Antigen Production

Recombinant Human UBE2L3 can also be used for antigen production, as it can elicit an immune response in the body. This is particularly useful in the development of vaccines or in diagnostic tests for diseases that involve the ubiquitin-proteasome pathway. By using UBE2L3 as an antigen, researchers can identify and target specific antibodies that may be involved in disease progression.

Conclusion

In summary, Recombinant Human UBE2L3 is a crucial protein in the ubiquitin-proteasome pathway, playing a key role in the degradation of unwanted or damaged proteins. Its structure, enzymatic activity, and wide range of applications make it a valuable tool in both research and clinical settings. As our understanding of the ubiquitin-proteasome pathway continues to grow, the importance of UBE2L3 in cellular function and disease development will only become more apparent.

Recombinant Human UBE2L3, N-His

There are no reviews yet.

Be the first to review “Recombinant Human UBE2L3, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products