Name: Staphylococcus AmiR1R2 Recombinant Protein
SKU: PX-P2063-10
Availability: InStock

Product name	Staphylococcus AmiR1R2 Recombinant Protein
Origin species	Staphylococcus
Expression system	Prokaryotic expression
Sequence	MAHNHRHKHKLIKMGKVAPWGTQSTTTPTTPSKPTTPSKPSTGKLTVAANNGVAQIKPTNSGLYTTVYDKTGKATNEVQKTFAVSKTATLGNQKFYLVQDYNSGNKFGWVKEGDVVYNTAKSPVNVNQSYSIKPGTKLYTVPWGTSKQVAGSVSGSGNQTFKASKQQQIDKSIYLYGSVNGKSGWVSKAYLVDTAKPTPTPTPKPSTPTTNNKLTVSSLNGVAQINAKNNGLFTTVYDKTGKPTKEVQKTFAVTK
Molecular weight	40.59 kDa
Protein delivered with Tag?	Yes
Purity estimated	80%
Buffer	PBS, pH 7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Unknown
Protein Accession	KEK49756.1
Spec:Entrez GeneID	12330922
Spec:SwissProtID	D9RNW1
NCBI Reference	KEK49756.1
Aliases /Synonyms	AmiR1R2, Bifunctional N-acetylmuramoyl-L-alanine amidase/endo-beta-N-acetylglucosaminidase, Atl
Reference	PX-P2063
Note	For research use only

No Products found