Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Staphylococcus AmiR1R2 Recombinant Protein
| Size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Staphylococcus AmiR1R2 Recombinant Protein |
|---|---|
| Origin species | Staphylococcus |
| Expression system | Prokaryotic expression |
| Sequence | MAHNHRHKHKLIKMGKVAPWGTQSTTTPTTPSKPTTPSKPSTGKLTVAANNGVAQIKPTNSGLYTTVYDKTGKATNEVQKTFAVSKTATLGNQKFYLVQDYNSGNKFGWVKEGDVVYNTAKSPVNVNQSYSIKPGTKLYTVPWGTSKQVAGSVSGSGNQTFKASKQQQIDKSIYLYGSVNGKSGWVSKAYLVDTAKPTPTPTPKPSTPTTNNKLTVSSLNGVAQINAKNNGLFTTVYDKTGKPTKEVQKTFAVTK |
| Molecular weight | 40.59 kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 80% |
| Buffer | PBS, pH 7.5 |
| Form | Frozen |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Unknown |
| Protein Accession | KEK49756.1 |
| Spec:Entrez GeneID | 12330922 |
| Spec:SwissProtID | D9RNW1 |
| NCBI Reference | KEK49756.1 |
| Aliases /Synonyms | AmiR1R2, Bifunctional N-acetylmuramoyl-L-alanine amidase/endo-beta-N-acetylglucosaminidase, Atl |
| Reference | PX-P2063 |
| Note | For research use only |
Related products
Biosimilar
Relatlimab Biosimilar – Anti-LAG3, CD223 mAb – Research Grade
PX-TA1496 238$Contact us
Send us a message from the form below
Reviews
There are no reviews yet.