Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Staphylococcus AmiR1R2 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Staphylococcus
Molecular weight:
40.59 kDa

Original price was: $349.00.Current price is: $308.00.

50ug 12% OFF + 308 loyalty points
Unknown Yes
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Staphylococcus AmiR1R2 Recombinant Protein

Product name Staphylococcus AmiR1R2 Recombinant Protein
Origin species Staphylococcus
Expression system Prokaryotic expression
Raw Antigen Sequence MAHNHRHKHKLIKMGKVAPWGTQSTTTPTTPSKPTTPSKPSTGKLTVAANNGVAQIKPTNSGLYTTVYDKTGKATNEVQKTFAVSKTATLGNQKFYLVQDYNSGNKFGWVKEGDVVYNTAKSPVNVNQSYSIKPGTKLYTVPWGTSKQVAGSVSGSGNQTFKASKQQQIDKSIYLYGSVNGKSGWVSKAYLVDTAKPTPTPTPKPSTPTTNNKLTVSSLNGVAQINAKNNGLFTTVYDKTGKPTKEVQKTFAVTK
Molecular weight 40.59 kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Unknown
Protein Accession KEK49756.1
Spec:Entrez GeneID 12330922
Spec:SwissProtID D9RNW1
NCBI Reference KEK49756.1
Aliases /Synonyms AmiR1R2, Bifunctional N-acetylmuramoyl-L-alanine amidase/endo-beta-N-acetylglucosaminidase, Atl
Reference PX-P2063
Note For research use only
Molecular Constructor
Unknown Yes
Product name Staphylococcus AmiR1R2 Recombinant Protein
Origin species Staphylococcus
Expression system Prokaryotic expression
Raw Antigen Sequence MAHNHRHKHKLIKMGKVAPWGTQSTTTPTTPSKPTTPSKPSTGKLTVAANNGVAQIKPTNSGLYTTVYDKTGKATNEVQKTFAVSKTATLGNQKFYLVQDYNSGNKFGWVKEGDVVYNTAKSPVNVNQSYSIKPGTKLYTVPWGTSKQVAGSVSGSGNQTFKASKQQQIDKSIYLYGSVNGKSGWVSKAYLVDTAKPTPTPTPKPSTPTTNNKLTVSSLNGVAQINAKNNGLFTTVYDKTGKPTKEVQKTFAVTK
Molecular weight 40.59 kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Unknown
Protein Accession KEK49756.1
Spec:Entrez GeneID 12330922
Spec:SwissProtID D9RNW1
NCBI Reference KEK49756.1
Aliases /Synonyms AmiR1R2, Bifunctional N-acetylmuramoyl-L-alanine amidase/endo-beta-N-acetylglucosaminidase, Atl
Reference PX-P2063
Note For research use only
Molecular Constructor
Unknown Yes
Product name PX-P2063-1MG
Origin species Staphylococcus
Expression system Prokaryotic expression
Raw Antigen Sequence MAHNHRHKHKLIKMGKVAPWGTQSTTTPTTPSKPTTPSKPSTGKLTVAANNGVAQIKPTNSGLYTTVYDKTGKATNEVQKTFAVSKTATLGNQKFYLVQDYNSGNKFGWVKEGDVVYNTAKSPVNVNQSYSIKPGTKLYTVPWGTSKQVAGSVSGSGNQTFKASKQQQIDKSIYLYGSVNGKSGWVSKAYLVDTAKPTPTPTPKPSTPTTNNKLTVSSLNGVAQINAKNNGLFTTVYDKTGKPTKEVQKTFAVTK
Molecular weight 40.59 kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Unknown
Protein Accession KEK49756.1
Spec:Entrez GeneID 12330922
Spec:SwissProtID D9RNW1
NCBI Reference KEK49756.1
Aliases /Synonyms AmiR1R2, Bifunctional N-acetylmuramoyl-L-alanine amidase/endo-beta-N-acetylglucosaminidase, Atl
Reference PX-P2063
Note For research use only
Molecular Constructor
Unknown Yes

Staphylococcus AmiR1R2 Recombinant Protein

There are no reviews yet.

Be the first to review “Staphylococcus AmiR1R2 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products