Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Transcription factor Sp5(SP5) |
|---|---|
| Uniprot ID | T2MC68 |
| Uniprot link | https://www.uniprot.org/uniprot/T2MC68 |
| Expression system | Prokaryotic expression |
| Sequence | MGSHHHHHHSGISPLEQTSPKKIFQPWNHTFESHNYDTPISPNSKVRHFLETNFSLPPSPPLKSEIVKVPPTIRPMPMTN VMQEKATLNYSQKLSPPPCLACSAGQKCNGINKISPVLLSPPASPISWLFPQNIIQSHPSKVSINEHHIKEYSEHSQADP TRFVNYVYKNVDSSQAKPNLIIRHDNMISSTQSYNNRIFSSSPHLTTTSHIYSMSTSI |
| Molecular weight | 24.5kDa |
| Protein delivered with Tag? | N-terminal His Tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS,pH7.5, 4Murea |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | IIe68-IIe274 |
| Protein Accession | CDG69495 |
| NCBI Reference | CDG69495 |
| Aliases /Synonyms | Transcription factor Sp5 |
| Reference | PX-P4603 |
| Note | For research use only |
Related products
Send us a message from the form below
Reviews
There are no reviews yet.