Skip to main content
Contact +1 (919) 234-1277

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Transcription factor Sp5(SP5)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
T2MC68
Molecular weight:
24.5kDa

$250.00

50ug + 250 loyalty points
His IIe68–IIe274
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Transcription factor Sp5(SP5)

Transcription factor Sp5(SP5)

Product name Transcription factor Sp5(SP5)
Uniprot ID T2MC68
Uniprot link https://www.uniprot.org/uniprot/T2MC68
Expression system Prokaryotic expression
Sequence MGSHHHHHHSGISPLEQTSPKKIFQPWNHTFESHNYDTPISPNSKVRHFLETNFSLPPSPPLKSEIVKVPPTIRPMPMTN VMQEKATLNYSQKLSPPPCLACSAGQKCNGINKISPVLLSPPASPISWLFPQNIIQSHPSKVSINEHHIKEYSEHSQADP TRFVNYVYKNVDSSQAKPNLIIRHDNMISSTQSYNNRIFSSSPHLTTTSHIYSMSTSI
Molecular weight 24.5kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS,pH7.5, 4Murea
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type IIe68-IIe274
Protein Accession CDG69495
NCBI Reference CDG69495
Aliases /Synonyms Transcription factor Sp5
Reference PX-P4603
Note For research use only
Molecular Constructor
His IIe68–IIe274
Product name Transcription factor Sp5(SP5)
Uniprot ID T2MC68
Uniprot link https://www.uniprot.org/uniprot/T2MC68
Expression system Prokaryotic expression
Sequence MGSHHHHHHSGISPLEQTSPKKIFQPWNHTFESHNYDTPISPNSKVRHFLETNFSLPPSPPLKSEIVKVPPTIRPMPMTN VMQEKATLNYSQKLSPPPCLACSAGQKCNGINKISPVLLSPPASPISWLFPQNIIQSHPSKVSINEHHIKEYSEHSQADP TRFVNYVYKNVDSSQAKPNLIIRHDNMISSTQSYNNRIFSSSPHLTTTSHIYSMSTSI
Molecular weight 24.5kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS,pH7.5, 4Murea
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type IIe68-IIe274
Protein Accession CDG69495
NCBI Reference CDG69495
Aliases /Synonyms Transcription factor Sp5
Reference PX-P4603
Note For research use only
Molecular Constructor
His IIe68–IIe274

There are no reviews yet.

Be the first to review “Transcription factor Sp5(SP5)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products