Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Tumor-associated calcium signal transducer 2(TACSTD2)
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | Tumor-associated calcium signal transducer 2(TACSTD2) |
|---|---|
| Uniprot ID | P09758 |
| Uniprot link | https://www.uniprot.org/uniprot/P09758 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT |
| Molecular weight | 35-45kDa |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >95% by SDS-PAGE |
| Buffer | PBS pH 7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Met1-Thr274 |
| Protein Accession | P09758 |
| Spec:Entrez GeneID | 4070 |
| Spec:NCBI Gene Aliases | EGP1; GP50; M1S1; EGP-1; TROP2; GA7331; GA733-1 |
| Spec:SwissProtID | Q15658 |
| NCBI Reference | P09758 |
| Aliases /Synonyms | GA733-1, M1S1, TROP2,Cell surface glycoprotein Trop-2；Membrane component chromosome 1 surface marker 1；Pancreatic carcinoma marker protein GA733-1 |
| Reference | PX-P4569 |
| Note | For research use only |
Related products
Biosimilar
Sacituzumab Biosimilar – Anti-TACSTD2 mAb – Research Grade
PX-TA1447 238$
Tag Antibody
Anti His tag mouse monoclonal antibody
PTX17851 215$Contact us
Send us a message from the form below
Reviews
There are no reviews yet.